DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox14

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001093703.1 Gene:sox14 / 100101715 XenbaseID:XB-GENE-485370 Length:239 Species:Xenopus tropicalis


Alignment Length:240 Identity:107/240 - (44%)
Similarity:117/240 - (48%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            |||||||||||||||||||||||:||||||||||||||||||||:|.:|||:|||||||||.|||
 Frog     6 DHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK 70

  Fly   184 EHPDYKYRPRRKPKTLNK--------------SPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPG 234
            ||||||||||||||.|.|              .|:..|..........|......|.....|.|.
 Frog    71 EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDHDPLKTGLSMSATDSLLGASEKARAFLPPTSAPY 135

  Fly   235 SVGSPKDMQ-------------------PQLSPLGQ--------SLPHLHGHPHQSPYQSHPHHP 272
            |:..|....                   |..|.||.        |.|..|.|.|.||  ::|.:.
 Frog   136 SLLDPSQFSSTTIQKMTEMPHTLAASTLPYASTLGYQNGAFGGLSCPSQHTHTHPSP--TNPGYV 198

  Fly   273 HPHPHHVQLAAATLSAKYGFGSPLELSLPRLPNAFPGLAHYPLDP 317
            .|         ...||    .|...|..|.....|||:....|||
 Frog   199 VP---------CNCSA----WSASNLQPPVAYILFPGMTKAGLDP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 64/70 (91%)
sox14NP_001093703.1 SOX-TCF_HMG-box 7..78 CDD:238684 64/70 (91%)
SOXp 77..>95 CDD:372055 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4714
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm49139
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.