DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox17b.2

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001090837.1 Gene:sox17b.2 / 100038235 XenbaseID:XB-GENE-495335 Length:351 Species:Xenopus tropicalis


Alignment Length:179 Identity:68/179 - (37%)
Similarity:96/179 - (53%) Gaps:11/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEG 165
            :|.|.....:..|...:...|:|||||||||::.:|:::||.||.:||:|:||.||..||.||..
 Frog    16 DAKTKKEAGSANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLA 80

  Fly   166 QKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKT-------LNKSPVPGGG--GGGGGGGANGGVN 221
            .||||:.||:|||..|::::||||||||||.:.       |..:.:||..  |.....|.|..:.
 Frog    81 SKRPFVKEAERLRVQHIQDYPDYKYRPRRKKQVKREEEGFLPSADIPGPQVMGCNAMVGQNYKMQ 145

  Fly   222 AGGAGNSGPSGPGSVGSPKDMQP-QLSPLGQSLPHLHGHPHQSPYQSHP 269
            ..|. ||..|.....|..:|..| .....|.::|..:...:.|.|.|.|
 Frog   146 YSGQ-NSQQSQITPAGYFEDHNPVGFYYRGYNVPKYYMSQNSSGYCSPP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 40/70 (57%)
sox17b.2NP_001090837.1 SOX-TCF_HMG-box 35..106 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.