DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox21

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_002939326.1 Gene:sox21 / 100038091 XenbaseID:XB-GENE-486445 Length:271 Species:Xenopus tropicalis


Alignment Length:280 Identity:114/280 - (40%)
Similarity:134/280 - (47%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            ||:||||||||||||.|||||||:||||||||||||||||||||||.:|||||||||||||:|||
 Frog     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTEAEKRPFIDEAKRLRAMHMK 70

  Fly   184 EHPDYKYRPRRKPKTLNKS-----PVPGGGGGGGGGGANGGVNAGG------------------- 224
            ||||||||||||||||.|.     |:|.|..|...|....|::..|                   
 Frog    71 EHPDYKYRPRRKPKTLLKKDKFAFPMPYGFTGDHDGLKVAGLHGAGALTDSLLSNPEKAAAAAAA 135

  Fly   225 -------------------AGNSGPSGPGSVGSPKDMQPQLSPLGQSLPHLH--GHPHQS----- 263
                               |...|.:.|.|:........:::....|||:..  |:|..|     
 Frog   136 AAARVFFPPSAAAAAAAAAAAAGGANHPYSLFDLSSKMAEITSSSSSLPYTSSIGYPQASGGAFP 200

  Fly   264 -----------PYQSHPH-HPHP-HPHHVQLAAATLSAKYGFGSPLELSLPRLPNAFPGLAHYPL 315
                       ....|.| ||.| :|.::.....|.....|...||...|      |||:....|
 Frog   201 GVAAAAAAAAAAGGGHTHSHPSPGNPGYMIPCNCTGWPSPGLQPPLAYIL------FPGMGKPQL 259

  Fly   316 DPTLALDLQARLQAMYAGSI 335
            ||..|        |.||.::
 Frog   260 DPYPA--------AAYAAAL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 64/70 (91%)
sox21XP_002939326.1 SOX-TCF_HMG-box 7..78 CDD:238684 64/70 (91%)
SOXp 77..>95 CDD:372055 11/17 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm49139
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.