DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and SKM1

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_014528.1 Gene:SKM1 / 854036 SGDID:S000005473 Length:655 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:83/309 - (26%)
Similarity:141/309 - (45%) Gaps:42/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 LDSNWEIPRQQLSLGSILGEGAFGRVVMAEAEGLPR--SPQLAET--------IVAVKMVK-EEH 754
            :|.|   ||....|....|:||.|.|.:::...||:  .|:..::        .||:|.:: .|.
Yeast   352 IDVN---PRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQ 413

  Fly   755 TDTDMASLVREMEVMKMIGKHINIINLL-GCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRR 818
            ....:  ::.|:.||. ..:..||:|.| ........||||:||...|.|.|.|     .|..|.
Yeast   414 PKKQL--IMNELLVMN-DSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDIL-----DAVARS 470

  Fly   819 SDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADF 883
            :..:         .:..|.|.::.....:..:|:::|.:::.||||:.:.|:|::...::||.||
Yeast   471 NTGE---------HSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDF 526

  Fly   884 GLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSA 948
            |...::.:....|....| .|. |||||.:.:|.||.:.||||.|::|.| |..|:.||   |:.
Yeast   527 GFCVELTEKRSKRATMVG-TPY-WMAPEIVNQKGYDEKVDVWSLGIMLIE-MIEGEPPY---LNE 585

  Fly   949 EELYS-YLITGQ---RMEKPAKCSLNIYVVMRQCWHFESCARPTFAELV 993
            :.|.: |||...   ::..|...|......:..|......:|.:..:|:
Yeast   586 DPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLL 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 83/309 (27%)
TyrKc 712..996 CDD:197581 79/298 (27%)
SKM1NP_014528.1 PH_Cla4_Ste20 4..113 CDD:270097
PBD 122..180 CDD:395634
STKc_PAK 359..640 CDD:270789 79/299 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.