DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and CRK13

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001078435.1 Gene:CRK13 / 828420 AraportID:AT4G23210 Length:673 Species:Arabidopsis thaliana


Alignment Length:576 Identity:126/576 - (21%)
Similarity:205/576 - (35%) Gaps:169/576 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 NQTVKVNGSLVMKCTVYSDLHPTVS-------WKRVVLKNASLDGLKSVEIQNLNFTVTNDSVVL 551
            |.|...|...:|:||      |.:|       .:|.||:..|..|              |::...
plant   191 NLTKFQNIYALMQCT------PDISSDECNNCLQRGVLEYQSCCG--------------NNTGGY 235

  Fly   552 TLRNVTFDQEGWYTCLASSGLGRSNSSVYLRVVSPL--PPLEIYALLHAHPLG------------ 602
            .:|.:.|.:...:|      ..::..::.|....||  |||:...:....|..            
plant   236 VMRPICFFRWQLFT------FSKAFHNITLATTPPLSPPPLQRPVVASQPPSADNRDKKRDNSSG 294

  Fly   603 ----FTLAAITIVALFLLGSAFITFMLRRLRREKLLKLRIETVHQWTKKVIIYRPGGEEGSGCSS 663
                .|:.||.:|.:.:|                               :||            |
plant   295 KISMKTILAIVVVGIVIL-------------------------------III------------S 316

  Fly   664 GDLQMPVIRIEKQRTTVSTTGTGGTDPAQGFNEYEFPLDSNWEIPRQQLSLGSILGEGAFGRVVM 728
            |.|.....|.||....|....||.|....  .:|:|.     .|.....:....||.|..|.|..
plant   317 GILARRFARKEKPYQEVELNQTGITSVRS--LQYKFK-----TIETATNNFSERLGHGGSGHVFK 374

  Fly   729 AEAEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWV 793
            .      |.|...|  :|||.:.|: |:........|:.::..: :|.|::.|||...:|....:
plant   375 G------RLPDGKE--IAVKRLSEK-TEQSKKEFKNEVVLVAKL-QHRNLVRLLGFSVKGEEKII 429

  Fly   794 IVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYL--- 855
            :.||.|:.:| |::..:    |.::.:.|.               |:..|.....|||:.||   
plant   430 VYEYLPNRSL-DYILFD----PTKQGELDW---------------KKRYKIIGGTARGILYLHQD 474

  Fly   856 ASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDS 920
            :....|||||.|.|:|:......|:||||.||.....:......|......:||||.::..::..
plant   475 SQPTIIHRDLKAGNILLDAHMNPKVADFGTARIFGMDQSVAITANAAGTPGYMAPEYMELGEFSM 539

  Fly   921 QSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSY-----------------LITGQRMEKPAKCS 968
            :|||:|||||:.||:. |.:........:...:|                 :....:.|:..:| 
plant   540 KSDVYSYGVLVLEIIC-GKRNTSFSSPVQNFVTYVWRLWKSGTPLNLVDATIAENYKSEEVIRC- 602

  Fly   969 LNIYVVMRQCWHFESCARPTFAELVESFDGILQQASSNPNDAYLDLSMPMLETPPS 1024
              |::.: .|...|...||.|:.       |:...:||      .|.:|:.:.|||
plant   603 --IHIAL-LCVQEEPTDRPDFSI-------IMSMLTSN------SLILPVPKPPPS 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653 18/95 (19%)
Ig 507..583 CDD:299845 14/82 (17%)
PKc_like 700..1000 CDD:304357 75/319 (24%)
TyrKc 712..996 CDD:197581 74/303 (24%)
CRK13NP_001078435.1 Stress-antifung 26..124 CDD:396296
Stress-antifung <175..245 CDD:396296 16/73 (22%)
STKc_IRAK 364..628 CDD:270968 75/305 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.