DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and CRK7

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_194046.2 Gene:CRK7 / 828414 AraportID:AT4G23150 Length:659 Species:Arabidopsis thaliana


Alignment Length:275 Identity:79/275 - (28%)
Similarity:123/275 - (44%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 TGGTDPAQGFNEYEFPLDSNWEIPRQQLSLGSI------------LGEGAFGRVVMAE-AEGLPR 736
            |.||.||  .:|     |....|...||...:|            :|.|.||.|.... :.|   
plant   304 TYGTTPA--LDE-----DDKTTIESLQLDYRAIQAATNDFSENNKIGRGGFGDVYKGTFSNG--- 358

  Fly   737 SPQLAETIVAVKMVKE--EHTDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAP 799
                  |.||||.:.:  |..||:..:   |:.|:..: :|.|::.:||...:.....::.||..
plant   359 ------TEVAVKRLSKTSEQGDTEFKN---EVVVVANL-RHKNLVRILGFSIEREERILVYEYVE 413

  Fly   800 HGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQH---LGEKELTKFAFQIARGMEYL---ASR 858
            :.:|.:||..     |.::..         |..||.   :|         .||||:.||   :..
plant   414 NKSLDNFLFD-----PAKKGQ---------LYWTQRYHIIG---------GIARGILYLHQDSRL 455

  Fly   859 RCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRL--PIKWMAPESLQEKKYDSQ 921
            ..|||||.|.|:|:......||||||:|| |...:..::||: |:  ...:|:||.....::..:
plant   456 TIIHRDLKASNILLDADMNPKIADFGMAR-IFGMDQTQQNTS-RIVGTYGYMSPEYAMRGQFSMK 518

  Fly   922 SDVWSYGVLLWEIMT 936
            |||:|:|||:.||::
plant   519 SDVYSFGVLVLEIIS 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 73/260 (28%)
TyrKc 712..996 CDD:197581 70/248 (28%)
CRK7NP_194046.2 Stress-antifung 32..127 CDD:279926
Stress-antifung 162..240 CDD:279926
TyrKc 339..603 CDD:197581 68/233 (29%)
STKc_IRAK 342..608 CDD:270968 68/230 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.