DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and ARSK1

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_180197.1 Gene:ARSK1 / 817169 AraportID:AT2G26290 Length:424 Species:Arabidopsis thaliana


Alignment Length:337 Identity:74/337 - (21%)
Similarity:129/337 - (38%) Gaps:68/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 SNWEIPRQQLSLGSILGEGAFGRVVMAEAE-----GLPRSPQLAETIVAVKMVKEEHTDTDMASL 762
            |...:.....|..::||||.||.|.....:     |:...|      ||||.:...........|
plant    79 SELRVITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGIEAQP------VAVKALDLHGHQGHREWL 137

  Fly   763 VREMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDD 827
            ...:.:.::..||  ::.|:|.|.:.....::.||.|.|:|::.|.:....|             
plant   138 AEILFLGQLSNKH--LVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNSLA------------- 187

  Fly   828 KPLISTQHLGEKELTKFAFQIARGMEYL--ASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQ 890
                    :......|.|...|:|:.:|  |.:..|:||....|:|:...|..|::|||||:|..
plant   188 --------MAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGP 244

  Fly   891 DTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMT------------------- 936
            :.|:....|.......:.|||.:......:.:||:|:||:|.|::|                   
plant   245 EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEW 309

  Fly   937 ----YGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFD 997
                ..||     ...|.:....:..|...:.|:.:.::   ..:|.......|||..|:|:..:
plant   310 ARPMLRDQ-----RKLERIIDPRLANQHKTEAAQVAASL---AYKCLSQHPKYRPTMCEVVKVLE 366

  Fly   998 GILQQASSNPND 1009
            .| |:.....:|
plant   367 SI-QEVDIRKHD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 71/326 (22%)
TyrKc 712..996 CDD:197581 70/313 (22%)
ARSK1NP_180197.1 STYKc 93..365 CDD:214568 69/308 (22%)
PKc_like 94..368 CDD:304357 69/310 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.