DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and obsl1a

DIOPT Version :10

Sequence 1:NP_729956.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_005166286.1 Gene:obsl1a / 796577 ZFINID:ZDB-GENE-060503-649 Length:2185 Species:Danio rerio


Alignment Length:944 Identity:181/944 - (19%)
Similarity:299/944 - (31%) Gaps:355/944 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 GYPRNTSIALGDNVSIECLLEDSALEPKITWLHKGNADNIDDLLQRLREQSQLPVDVTRLITRMD 309
            ||||...:..|.:..::|.:.... :|.:.|..|..:.:.:.   |.|            ||:..
Zfish    12 GYPRPVLVKCGTDAVLKCQIGGDP-QPDVIWERKNESIHPEG---RYR------------ITQDG 60

  Fly   310 EPQVLRLGNVLMEDGGWYICIAENQVGRTVAASYVDLYSPSDTTTVRTTT----TTTVASPIPTA 370
            :...|.:..|.|||.|.|||.|:|.:|.|.||:         |..|:..|    |....:|.|  
Zfish    61 KVYTLNISGVTMEDAGQYICRAKNNIGETYAAA---------TLKVQEETQEQQTQPAQAPPP-- 114

  Fly   371 STGEDNDDDVENPAAEASGGVGPPV-FRKELKRLQHS--------LS-----GNTVNLACPVYGK 421
               :.||..|..|..:....:...| ..|:....|.|        ||     |.....:|.:.|.
Zfish   115 ---QQNDVQVIPPEQDMKMKIQQQVGVEKKKDPFQDSKPYFLIKPLSLRVDRGEDAAFSCKITGD 176

  Fly   422 --ANITWTKDKKPLNRELGVYVQKNW----------TLRFVEATSEDSGLYNCKVCNAWGCIQFD 474
              ..:.|.||.|.||.   :|...::          .|:..:..:.|.|:|.||..|..|     
Zfish   177 PLPQVVWEKDGKQLNE---IYESAHYHVGQQDGGWFQLKIFKTRTPDGGVYMCKAVNKHG----- 233

  Fly   475 FSVQINDRTRSAPIIV--------------------VPQNQTVK------VNGSLVMKCTVYSDL 513
                  :....|.::|                    .||:...|      :|.|...|.||....
Zfish   234 ------EAITGAVLLVEPIPEHREGSMTNGYTNGHYSPQHSRAKHSKEPHLNVSKAKKFTVTEGK 292

  Fly   514 H------------PTVSWKRVVLKNASLDGLKSVEIQNLNFTVTNDSVVL-TLRNVTF-DQEGWY 564
            |            |.:.|||                        |..::: :.|::.| |:||:|
Zfish   293 HAKFRCYVTGKPKPEIVWKR------------------------NGEIIMPSRRHLIFEDREGYY 333

  Fly   565 T---------------CLASSGLGRSNSSVYLRVVSPLPPLEIYALLHAHPLGFTLAAITIVALF 614
            |               |.||:.||.:.|:|.|.|..|             |:.|..|        
Zfish   334 TLKVLYCKQQDTGLYICAASNALGNTLSAVQLSVKGP-------------PVRFKRA-------- 377

  Fly   615 LLGSAFITFMLRRLRREKLLKLRIETVHQWTKKVIIYRPGGEEGSGCSSGDLQMPVIRIEKQRTT 679
            |..|.|         ||:                                  .:.|:..|....:
Zfish   378 LQDSEF---------RER----------------------------------DVAVLECEVPEES 399

  Fly   680 VSTTGTGGTDPAQGFNEYEFPLDSNWEIPRQQLSL--------GSILGEGAFGRVVMAE------ 730
            :||.........|..|:|.......|    ::|::        |..|.|...|...:||      
Zfish   400 ISTAWYLEDQRLQHGNKYNMEQKGTW----RRLTIQNVGADDDGVYLCEMPDGGKTIAELAVKGT 460

  Fly   731 -AEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREME-------VMKMIGK-HI---------- 776
             .:.|||..::.|...|...|:.|..|.|:......::       ::|..|| ||          
Zfish   461 IVKKLPRRLEVMEGENAAFFVEVEQDDMDICWFKDGLQLQETHQTIIKSFGKTHILVFVNTSYQD 525

  Fly   777 --NIINLLG-----------------------------CCSQGGPLWVIVEYAPHGNLKD----- 805
              .|..:.|                             ||..|    |::.::|..||::     
Zfish   526 SGTITFMAGRSTTSSKLRVKTARHCPPICPVGVQMNTDCCQNG----VVLSWSPSPNLQNSTTKS 586

  Fly   806 --FLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTK--FAFQIARGMEYLAS-----RRCI 861
              .|::...|:.:.:.    .|..:...|.:.||:....:  |.|:|....:|..|     .:.:
Zfish   587 VYVLERQEVGSQEWQR----CLTTETGTSAEVLGDSVPCEGDFRFRICCVNKYGRSGHVEFPKVV 647

  Fly   862 HRDLA--------ARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKY 918
            |  ||        .:|.:|::|              :|..:..:.::..:...::..:.||:.::
Zfish   648 H--LAPGPKIKSPLKNAVVTEG--------------EDAVFSIELSSELIGTWFLNSQQLQQSEH 696

  Fly   919 DSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFES 983
            .|.:...:..:|       ..:..|::....|: :::.||.|    ...||.|.|          
Zfish   697 FSMTQSKNQHIL-------RIRQVPNVYDGAEI-TFIATGVR----DSASLQIKV---------- 739

  Fly   984 CARPTFAELVESFDGILQQASSNPNDAYLDLSMP 1017
             ....|..|.| .|........||...|.::|.|
Zfish   740 -CEVKFLPLSE-MDTKKSTELGNPIVLYCEVSQP 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_729956.1 Ig 143..215 CDD:472250
Ig strand B 160..164 CDD:409570
Ig strand C 175..179 CDD:409570
Ig strand E 197..201 CDD:409570
Ig strand F 211..215 CDD:409570
Ig_3 247..333 CDD:464046 21/85 (25%)
Ig 398..479 CDD:472250 23/105 (22%)
Ig strand B 412..416 CDD:409393 0/3 (0%)
Ig strand C 423..427 CDD:409393 0/3 (0%)
Ig strand E 445..449 CDD:409393 1/13 (8%)
Ig strand F 459..464 CDD:409393 2/4 (50%)
Ig strand G 472..475 CDD:409393 0/2 (0%)
IG_like 492..583 CDD:214653 29/125 (23%)
Ig strand B 503..507 CDD:409444 0/3 (0%)
Ig strand C 516..520 CDD:409444 0/3 (0%)
Ig strand E 549..553 CDD:409444 0/4 (0%)
Ig strand F 563..568 CDD:409444 3/19 (16%)
Ig strand G 576..579 CDD:409444 1/2 (50%)
Protein Kinases, catalytic domain 700..1000 CDD:473864 66/385 (17%)
obsl1aXP_005166286.1 I-set 8..97 CDD:400151 29/109 (27%)
Ig strand B 25..29 CDD:409390 0/3 (0%)
Ig strand C 38..43 CDD:409390 1/4 (25%)
Ig strand E 63..67 CDD:409390 1/3 (33%)
Ig strand F 77..82 CDD:409390 3/4 (75%)
Ig strand G 90..93 CDD:409390 1/2 (50%)
I-set 150..243 CDD:400151 21/106 (20%)
Ig strand B 167..171 CDD:409405 0/3 (0%)
Ig strand C 180..184 CDD:409405 0/3 (0%)
Ig strand E 209..213 CDD:409405 1/3 (33%)
Ig strand F 223..228 CDD:409405 2/4 (50%)
Ig strand G 236..239 CDD:409405 0/2 (0%)
I-set 284..367 CDD:400151 24/106 (23%)
Ig strand B 294..298 CDD:409405 0/3 (0%)
Ig strand C 307..311 CDD:409405 0/3 (0%)
Ig strand E 333..337 CDD:409405 2/3 (67%)
Ig strand F 347..352 CDD:409405 1/4 (25%)
Ig strand G 360..363 CDD:409405 1/2 (50%)
Ig 373..443 CDD:472250 17/124 (14%)
Ig strand B 389..393 CDD:409559 1/3 (33%)
Ig strand C 401..405 CDD:409559 2/3 (67%)
Ig strand E 426..430 CDD:409559 1/3 (33%)
Ig strand F 440..445 CDD:409559 1/4 (25%)
Ig strand G 450..453 CDD:409559 0/2 (0%)
Ig 464..544 CDD:472250 16/79 (20%)
Ig strand B 477..481 CDD:409559 1/3 (33%)
Ig strand C 489..493 CDD:409559 1/3 (33%)
Ig strand E 514..518 CDD:409559 2/3 (67%)
Ig strand F 528..533 CDD:409559 1/4 (25%)
Ig strand G 537..540 CDD:409559 0/2 (0%)
FN3 567..638 CDD:238020 15/78 (19%)
Ig 653..739 CDD:472250 16/111 (14%)
Ig_3 757..820 CDD:464046 5/15 (33%)
Ig 856..921 CDD:472250
Ig strand C 866..870 CDD:409559
Ig strand E 891..895 CDD:409559
Ig strand F 905..910 CDD:409559
Ig strand G 914..917 CDD:409559
Ig 944..1012 CDD:472250
Ig strand B 945..949 CDD:409559
Ig strand C 957..961 CDD:409559
Ig strand E 982..986 CDD:409559
Ig strand F 996..1001 CDD:409559
Ig strand G 1005..1008 CDD:409559
Ig 1022..1104 CDD:472250
Ig strand B 1037..1041 CDD:409559
Ig strand C 1049..1053 CDD:409559
Ig strand E 1074..1078 CDD:409559
Ig strand F 1088..1093 CDD:409559
Ig strand G 1097..1100 CDD:409559
Ig 1122..1196 CDD:472250
Ig strand B 1129..1133 CDD:409559
Ig strand C 1141..1145 CDD:409559
Ig strand E 1166..1170 CDD:409559
Ig strand F 1180..1185 CDD:409559
Ig strand G 1189..1192 CDD:409559
Ig 1220..1288 CDD:472250
Ig strand B 1221..1225 CDD:409559
Ig strand C 1233..1237 CDD:409559
Ig strand E 1258..1262 CDD:409559
Ig strand F 1272..1277 CDD:409559
Ig strand G 1281..1284 CDD:409559
Ig 1310..1380 CDD:472250
Ig strand B 1313..1317 CDD:409559
Ig strand C 1325..1329 CDD:409559
Ig strand E 1350..1354 CDD:409559
Ig strand F 1364..1369 CDD:409559
Ig strand G 1373..1376 CDD:409559
Ig 1397..1470 CDD:472250
Ig strand B 1404..1408 CDD:409559
Ig strand C 1416..1420 CDD:409559
Ig strand E 1440..1444 CDD:409559
Ig strand F 1454..1459 CDD:409559
Ig strand G 1463..1466 CDD:409559
Ig 1476..1559 CDD:472250
Ig strand B 1492..1496 CDD:409559
Ig strand C 1504..1508 CDD:409559
Ig strand E 1529..1533 CDD:409559
Ig strand F 1543..1548 CDD:409559
Ig strand G 1552..1555 CDD:409559
Ig 1566..1649 CDD:472250
Ig strand B 1582..1586 CDD:409353
Ig strand C 1595..1598 CDD:409353
Ig strand E 1619..1623 CDD:409353
Ig strand F 1633..1638 CDD:409353
Ig strand G 1651..1654 CDD:409353
Ig 1662..1738 CDD:472250
Ig strand B 1671..1675 CDD:409559
Ig strand C 1683..1687 CDD:409559
Ig strand E 1708..1712 CDD:409559
Ig strand F 1722..1727 CDD:409559
Ig strand G 1731..1734 CDD:409559
IG_like 1751..1827 CDD:214653
Ig 1841..1916 CDD:472250
Ig strand B 1849..1853 CDD:409559
Ig strand C 1861..1865 CDD:409559
Ig strand E 1886..1890 CDD:409559
Ig strand F 1900..1905 CDD:409559
Ig strand G 1909..1912 CDD:409559
Ig 1924..2005 CDD:472250
Ig strand B 1938..1942 CDD:409541
Ig strand C 1951..1954 CDD:409541
Ig strand E 1975..1979 CDD:409541
Ig strand F 1989..1994 CDD:409541
Ig strand G 2002..2006 CDD:409541
Ig 2011..2094 CDD:472250
Ig strand B 2027..2031 CDD:409353
Ig strand C 2039..2043 CDD:409353
Ig strand E 2064..2068 CDD:409353
Ig strand G 2087..2090 CDD:409353
Ig 2101..2184 CDD:472250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.