DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and PDGFRL

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001359002.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:349 Identity:77/349 - (22%)
Similarity:124/349 - (35%) Gaps:109/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLSDMDITLQCVRPMAKWFYE---DKFQ---------LRATLLRLERAQSGNSGNYGCLDSQNRW 97
            ||:...:.|:|......|.|.   |.|:         .|...|.|..:.|.::|.:.|      |
Human    86 LLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSC------W 144

  Fly    98 YNISLVVGHKEPVGNDIASFVKLEDAPALPESDLFFQPLNESRSLKLLQPLPKTVQRTAGGLFQL 162
            ..:             .:.::..:|......:.:||....|     |..|.|.          ..
Human   145 VQL-------------CSGYICRKDEAKTGSTYIFFTEKGE-----LFVPSPS----------YF 181

  Fly   163 NCSPMDPDAKGV----------NISWLH----------NDTQILGGRGRIKLKRWSLTVGQLQP- 206
            :...::||.:.|          .:: ||          |.|.|:     ..:||..:   .||| 
Human   182 DVVYLNPDRQAVVPCRVTVLSAKVT-LHREFPAKEIPANGTDIV-----YDMKRGFV---YLQPH 237

  Fly   207 -EDAGSYHCELCVEQDCQRSNPTQLEVISRKHTVPMLKPGYPRNTSIA------LGDNVSIEC-L 263
             |..|..:|........|.|...||..::    ||   .|.|..|.:|      .||::|:.| :
Human   238 SEHQGVVYCRAEAGGRSQISVKYQLLYVA----VP---SGPPSTTILASSNKVKSGDDISVLCTV 295

  Fly   264 LEDSALEPKITWLHKGNADNIDDLLQRLREQSQLPVDVTRLI-------TRMDEPQVLRLGNVLM 321
            |.:..:|.:.||:..|..|.....:|          |..|||       ||:.: .|:.:.:...
Human   296 LGEPDVEVEFTWIFPGQKDERPVTIQ----------DTWRLIHRGLGHTTRISQ-SVITVEDFET 349

  Fly   322 EDGGWYICIAENQVGRTVAASYVD 345
            .|.|:|||.|:|..|:|..|:.|:
Human   350 IDAGYYICTAQNLQGQTTVATTVE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653 21/104 (20%)
IGc2 157..215 CDD:197706 15/79 (19%)
IG 247..336 CDD:214652 28/102 (27%)
Ig 258..340 CDD:143165 25/89 (28%)
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357
TyrKc 712..996 CDD:197581
PDGFRLNP_001359002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653 14/64 (22%)
Ig 293..372 CDD:386229 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.