DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and pdgfrl

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_956608.2 Gene:pdgfrl / 393284 ZFINID:ZDB-GENE-040426-901 Length:371 Species:Danio rerio


Alignment Length:422 Identity:94/422 - (22%)
Similarity:144/422 - (34%) Gaps:161/422 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PALPESD-------LFFQPLNESRSLKLLQPLPKTVQRTAGGLFQLNCSPMDPDAKGVNISWLH- 180
            |.:.|.|       :..|.|::.|.|:    |.:::....|...:|.|       ||..|.|.: 
Zfish    47 PKVKEKDTGSKGQSILTQVLDKGRFLR----LGESLSLNPGKTLELRC-------KGTKIGWAYP 100

  Fly   181 ------NDTQILGGRGRIKLKRWSLTVGQL-----QPEDAGSYHC--ELCVEQDCQRSNPT---- 228
                  ||       .|:.:|:.. ..|||     ...|.|.|.|  .||..|:|::...|    
Zfish   101 SYLDTFND-------NRLSIKQHE-RYGQLILTSPSAADTGEYSCWVLLCDGQECEKDVDTISAT 157

  Fly   229 --------QLEVISRKH-TVPMLKPGYPRNTSIALGDNVSIECLLEDSALEPKI-TWLHKGNADN 283
                    :|.|.|..| .:..|:|..|          .:|.|.:.:    ||| ..||      
Zfish   158 YIYFTDKDELFVPSAIHFEIIYLRPDKP----------ATIPCRVTN----PKIKVSLH------ 202

  Fly   284 IDDLLQRLRE--QSQLPVDVTRLITRMDEPQVLRLGNVLMEDGGWYICIAENQVGRT---VAASY 343
                    ||  ..::.||.|::.....:..:::  |...|..|.|.|.| |...:|   ::..|
Zfish   203 --------REVPAEEIAVDGTQISYNPTKGFIIQ--NPSPEHKGAYYCKA-NSTSKTTPQISTKY 256

  Fly   344 VDLYSPSDTTTVRTTTTTTVASPIPTASTGEDNDDDVENPAAEASGGVGPPVFRKELKRLQHSLS 408
            ..||                                ||.|:       |||.  ..::...:|:|
Zfish   257 QLLY--------------------------------VEVPS-------GPPF--ATIEASSNSVS 280

  Fly   409 GNTV-NLACPVYGK----ANITWT---KDKKPLNRELGVYVQKNWTL--RFVEATSE-------- 455
            |..| |:.|.|.|:    .:.:|.   :|::|:|      :|.:|.|  |.|..|:.        
Zfish   281 GGDVFNVTCTVLGEPEMNVSFSWRYPGQDQRPVN------IQDSWRLINRGVGHTTRISHSVMIV 339

  Fly   456 ------DSGLYNCKVCNAWGCIQFDFSVQIND 481
                  |.|.|.|...|..|......||:..|
Zfish   340 DDVETIDYGKYICTAKNKNGETLVATSVKSRD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653 24/108 (22%)
IGc2 157..215 CDD:197706 18/71 (25%)
IG 247..336 CDD:214652 20/91 (22%)
Ig 258..340 CDD:143165 20/87 (23%)
I-set 394..479 CDD:254352 27/108 (25%)
IGc2 408..469 CDD:197706 22/84 (26%)
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357
TyrKc 712..996 CDD:197581
pdgfrlNP_956608.2 IG_like 178..249 CDD:214653 22/101 (22%)
Ig 186..249 CDD:143165 19/83 (23%)
Ig 287..356 CDD:299845 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.