DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and Fgfrl1

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus


Alignment Length:571 Identity:150/571 - (26%)
Similarity:212/571 - (37%) Gaps:166/571 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 PRNTSIALGDNVSIECLLEDSALEPKIT-WLHKGNADNIDDLLQRLREQSQLPVDVTRLITRMDE 310
            ||..: .||..|.::|.:|..  .|.:| |...|.  .|.....|.|..                
  Rat    33 PRQVA-RLGRTVRLQCPVEGD--PPPLTMWTKDGR--TIHSGWSRFRVL---------------- 76

  Fly   311 PQVLRLGNVLMEDGGWYICIAENQVGRTVAASY----VDLYSPSDTTTVRTTTTTTVASPIPTAS 371
            ||.|::..|..||.|.|:|.|.|..| :::.:|    :|..||..            .:|.|..|
  Rat    77 PQGLKVKEVEAEDAGVYVCKATNGFG-SLSVNYTLIIMDDISPGK------------ENPGPGGS 128

  Fly   372 TGEDNDDDVENPAAEASGGVGPPVFRKELKRLQHSLS---GNTVNLACPVYG--KANITWTKDKK 431
            :| ..:|.|....|.       |.|.:..|..:..::   |::|.|.|...|  :.:|.|.||.:
  Rat   129 SG-GQEDPVSQQWAR-------PRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQ 185

  Fly   432 PLNR-ELGVYVQKNWTLRFVEATSEDSGLYNCKVCNAWGCIQFDFSVQINDRTRSAPII--VVPQ 493
            .|.| |...:.:|.|||.......||||.|.|:|.|..|.|...:.|.:..||||.|::  ..|.
  Rat   186 TLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPV 250

  Fly   494 NQTVKVNGSLVMKCTVYSDLHPTVSW-KRVVL-----KNASLD--GLKSVEIQNLNFTVTNDSVV 550
            |.||...|:...:|.|.||:.|.:.| |||..     .|:::|  |.|.|.:...:.....|...
  Rat   251 NTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSY 315

  Fly   551 LT---LRNVTFDQEGWYTCLASSGLGRSNSSVYLRVV----SPLPPLEIYALLHAHPLGFTLAAI 608
            |.   :.....|..|.|.||.::.:|.|..|.:|.|:    .|.||:       ||....|....
  Rat   316 LNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPV-------AHSSSTTSLPW 373

  Fly   609 TIVALFLLGSAFITFMLRRLRREKLLKLRIETVHQW---TKK----------VIIYRPGGEEGSG 660
            .:|.....|:.||                :.||..|   |||          |..:||.|.  |.
  Rat   374 PVVIGIPAGAVFI----------------LGTVLLWLCQTKKKPCAPASTLPVPGHRPPGT--SR 420

  Fly   661 CSSGDLQMPVIRI---EKQRTTV---------STTG-------------------------TGGT 688
            ..|||..:|.:.:   |:..:|:         ||.|                         .|| 
  Rat   421 ERSGDKDLPSLAVGICEEHGSTMAPQHILAPGSTAGPKLYPKLYTDVHTHTHTHTCTHTLSCGG- 484

  Fly   689 DPAQGFNEYEFPLD----SNWEI---------PRQQLSLGSILGEGAFGRV 726
               ||.:....||.    :|.:.         ||||  :|.|...|  |||
  Rat   485 ---QGSSAPACPLSVLNTANLQALCPEVGVWGPRQQ--VGRIENNG--GRV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652 25/89 (28%)
Ig 258..340 CDD:143165 22/82 (27%)
I-set 394..479 CDD:254352 30/90 (33%)
IGc2 408..469 CDD:197706 24/66 (36%)
IG_like 492..583 CDD:214653 30/101 (30%)
Ig 507..583 CDD:299845 25/86 (29%)
PKc_like 700..1000 CDD:304357 13/40 (33%)
TyrKc 712..996 CDD:197581 6/15 (40%)
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151 27/100 (27%)
Ig strand A' 35..38 CDD:409353 0/3 (0%)
Ig strand B 41..50 CDD:409353 2/8 (25%)
Ig strand C 56..61 CDD:409353 2/4 (50%)
Ig strand C' 64..67 CDD:409353 0/4 (0%)
Ig strand D 72..77 CDD:409353 2/20 (10%)
Ig strand E 78..84 CDD:409353 2/5 (40%)
Ig strand F 91..99 CDD:409353 4/7 (57%)
Ig strand G 102..112 CDD:409353 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152 12/54 (22%)
IgI_2_FGFRL1-like 143..234 CDD:409442 30/90 (33%)
Ig strand B 164..168 CDD:409442 2/3 (67%)
Ig strand C 177..181 CDD:409442 1/3 (33%)
Ig strand E 200..204 CDD:409442 3/3 (100%)
Ig strand F 214..219 CDD:409442 2/4 (50%)
Ig strand G 227..230 CDD:409442 0/2 (0%)
Ig 242..350 CDD:416386 30/107 (28%)
Ig strand A 242..245 CDD:409353 1/2 (50%)
Ig strand A' 249..253 CDD:409353 2/3 (67%)
Ig strand B 261..268 CDD:409353 2/6 (33%)
Ig strand C 272..279 CDD:409353 2/6 (33%)
Ig strand D 304..309 CDD:409353 0/4 (0%)
Ig strand E 317..322 CDD:409353 0/4 (0%)
Ig strand F 330..338 CDD:409353 4/7 (57%)
Ig strand G 341..349 CDD:409353 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.