DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and CG10702

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:307 Identity:56/307 - (18%)
Similarity:101/307 - (32%) Gaps:121/307 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VTVENSPRQRHLLSDMDITLQCVRPMAKWFYEDKFQLRATLLRLERAQSGNSGNYGCLDSQNRWY 98
            :|:.|...:..|.... .:::.||...|.:...:.:....|..|||.                  
  Fly   338 ITIRNKVNETQLYQSF-TSMREVRGHVKVYRSSQLRSLQFLRNLERV------------------ 383

  Fly    99 NISLVVGHKEPVGNDIASFVKLEDAPALPESDLFFQPLNESRSLKLLQPLPKTVQRTAGGLFQLN 163
                   |.:|:.|...||: |.|...|.|   .:.|   ||.|:.::          ||:|   
  Fly   384 -------HGDPLENRHYSFI-LYDNKELSE---LWTP---SRQLEFME----------GGMF--- 421

  Fly   164 CSPMDPDAKGVNISWLHNDTQILGGRGR-----IKLKRWSLTVGQLQPEDAGSYHCELCVEQDCQ 223
                           :|.:.::...|.|     :...|   .:..||..|.         |..| 
  Fly   422 ---------------MHRNNKLCNRRMREFQNAVTHDR---ALDSLQTNDQ---------EVQC- 458

  Fly   224 RSNPTQLEVISRKHTVPMLKPGYPRNTSIALGDNVSIECLLEDSALEPKITWLHKGNADNIDDLL 288
              :|.:|::..:|.|          :.|:                   |::||....:..| :|:
  Fly   459 --SPLKLQLYVQKRT----------HRSV-------------------KLSWLKSQTSQKI-ELI 491

  Fly   289 QR-------LREQSQLPVDVTRLITRMDEPQVLRLGNVLMEDGGWYI 328
            .|       ..|:|:|...:   .||::..:.|...:.|:|:|..|:
  Fly   492 HRPLLPGKLYHEESELDAPI---CTRINWKRRLLFPDDLIENGTHYL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653 14/87 (16%)
IGc2 157..215 CDD:197706 10/62 (16%)
IG 247..336 CDD:214652 17/89 (19%)
Ig 258..340 CDD:143165 16/78 (21%)
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357
TyrKc 712..996 CDD:197581
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382 29/163 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.