DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and F40G9.8

DIOPT Version :9

Sequence 1:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001367839.1 Gene:F40G9.8 / 185556 WormBaseID:WBGene00018244 Length:273 Species:Caenorhabditis elegans


Alignment Length:193 Identity:42/193 - (21%)
Similarity:71/193 - (36%) Gaps:58/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 VGPP---VFRKEL----KRLQHSLSGNTVNLACPVYGKANITWTKDKKPLNRELGVYVQKNWTLR 448
            ||||   :|.:|.    .|||.|.|..:.:      .:|.|..|     ::|:.|..|..|:. :
 Worm    26 VGPPSFSIFDQEFYTPGTRLQISCSSTSTS------PEALILET-----ISRKFGSLVAANYN-K 78

  Fly   449 FVEATSEDSGLYNCKVCNAWGCIQFDFSV---QINDRTRSAPIIVVPQN--------------QT 496
            .|:.|.|....||..       ::.|..|   ::..:..|..:|.|...              |.
 Worm    79 VVDGTFESGVFYNIS-------LKEDLEVRCWKVGKKIPSIKLINVADGPAKTFYEFEKSSHLQK 136

  Fly   497 VKVNGSLV-MKCTV-YSDLHPTVSWKRVVLKNASLDGLKSVEIQNLNFTVTNDSVVLTLRNVT 557
            ...:|..| :.|:: :|..:..|||            |..:.: |......:...:.||||::
 Worm   137 SAYDGDTVHLICSIPHSATNWEVSW------------LPDLPV-NTRIHEKSKYFISTLRNIS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352 22/94 (23%)
IGc2 408..469 CDD:197706 13/60 (22%)
IG_like 492..583 CDD:214653 14/82 (17%)
Ig 507..583 CDD:299845 11/52 (21%)
PKc_like 700..1000 CDD:304357
TyrKc 712..996 CDD:197581
F40G9.8NP_001367839.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.