DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and F40G9.8

DIOPT Version :10

Sequence 1:NP_729956.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001367839.1 Gene:F40G9.8 / 185556 WormBaseID:WBGene00018244 Length:273 Species:Caenorhabditis elegans


Alignment Length:226 Identity:52/226 - (23%)
Similarity:80/226 - (35%) Gaps:75/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VRPMAKWFYEDKFQLRATLLRLERAQSGN----------SGNYGCLDSQNR------------WY 98
            |.|.:...::.:|....|.|::..:.:..          |..:|.|.:.|.            :|
 Worm    26 VGPPSFSIFDQEFYTPGTRLQISCSSTSTSPEALILETISRKFGSLVAANYNKVVDGTFESGVFY 90

  Fly    99 NISLVVGHKE-------PVGNDIAS--FVKLEDAPALPESDLFFQPLNESRSLKLLQPLPKTVQR 154
            ||||    ||       .||..|.|  .:.:.|.||..     |....:|..|          |:
 Worm    91 NISL----KEDLEVRCWKVGKKIPSIKLINVADGPAKT-----FYEFEKSSHL----------QK 136

  Fly   155 TA--GGLFQLNCSPMDPDAKGVNISWLHN---DTQILGGRGRIKLKRWSLTVGQLQPEDAGSYH- 213
            :|  |....|.|| :...|....:|||.:   :|:|     ..|.|.:..|:     .:..||. 
 Worm   137 SAYDGDTVHLICS-IPHSATNWEVSWLPDLPVNTRI-----HEKSKYFISTL-----RNISSYEV 190

  Fly   214 CELCVEQDCQRSNPTQLEVISRKHTVPMLKP 244
            |...::.|  :..|..||      ||..:||
 Worm   191 CTCVIKTD--KFEPMFLE------TVIDVKP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_729956.1 Ig 143..215 CDD:472250 17/77 (22%)
Ig strand B 160..164 CDD:409570 1/3 (33%)
Ig strand C 175..179 CDD:409570 1/3 (33%)
Ig strand E 197..201 CDD:409570 0/3 (0%)
Ig strand F 211..215 CDD:409570 2/4 (50%)
Ig_3 247..333 CDD:464046
Ig 398..479 CDD:472250
Ig strand B 412..416 CDD:409393
Ig strand C 423..427 CDD:409393
Ig strand E 445..449 CDD:409393
Ig strand F 459..464 CDD:409393
Ig strand G 472..475 CDD:409393
IG_like 492..583 CDD:214653
Ig strand B 503..507 CDD:409444
Ig strand C 516..520 CDD:409444
Ig strand E 549..553 CDD:409444
Ig strand F 563..568 CDD:409444
Ig strand G 576..579 CDD:409444
Protein Kinases, catalytic domain 700..1000 CDD:473864
F40G9.8NP_001367839.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.