DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btl and C25A8.5

DIOPT Version :10

Sequence 1:NP_729956.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_501081.1 Gene:C25A8.5 / 182879 WormBaseID:WBGene00016085 Length:416 Species:Caenorhabditis elegans


Alignment Length:288 Identity:89/288 - (30%)
Similarity:142/288 - (49%) Gaps:48/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 LDSNWEIPRQQLSLGSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTDTD-MASLVR 764
            |...|||...|:.|...|||||||.|...:   |.......|. .|:|..|.|..:.: :..::|
 Worm   109 LKQPWEIEHSQVELTKKLGEGAFGEVWKGK---LTLKNGTVEN-CAIKTAKLESLNKEQIKEIMR 169

  Fly   765 EMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKP 829
            |..:|:.: .|.|::...|..:...||:||:|.|..|.|..:|::|....|.::.:         
 Worm   170 EARLMRNL-DHPNVVKFYGVGASQEPLYVIMELADCGALDSYLQKNPNLLPGKKME--------- 224

  Fly   830 LISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEY 894
                          ..:|.|.|:.|:..::.:|||:||||.|..:|.| |||||||:|   :...
 Worm   225 --------------MIYQAACGIAYMHEKKLLHRDIAARNCLYGEGQV-KIADFGLSR---EGNS 271

  Fly   895 YRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQ 959
            |..:...::||:|:|||:|:...|..:|||:::|::.|||...|.:|||. :...|:..|:.:|.
 Worm   272 YVMDLTKKVPIRWLAPETLKAGIYSPKSDVFAFGIMAWEITENGKEPYPD-MRVSEVVGYVRSGH 335

  Fly   960 RME-KPAKCSLNIYV-------VMRQCW 979
            ||. .|      ::|       |.:.||
 Worm   336 RMRFDP------VFVDFRFGEYVTKHCW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btlNP_729956.1 Ig 143..215 CDD:472250
Ig strand B 160..164 CDD:409570
Ig strand C 175..179 CDD:409570
Ig strand E 197..201 CDD:409570
Ig strand F 211..215 CDD:409570
Ig_3 247..333 CDD:464046
Ig 398..479 CDD:472250
Ig strand B 412..416 CDD:409393
Ig strand C 423..427 CDD:409393
Ig strand E 445..449 CDD:409393
Ig strand F 459..464 CDD:409393
Ig strand G 472..475 CDD:409393
IG_like 492..583 CDD:214653
Ig strand B 503..507 CDD:409444
Ig strand C 516..520 CDD:409444
Ig strand E 549..553 CDD:409444
Ig strand F 563..568 CDD:409444
Ig strand G 576..579 CDD:409444
Protein Kinases, catalytic domain 700..1000 CDD:473864 89/288 (31%)
C25A8.5NP_501081.1 SH2_Fps_family 4..98 CDD:198224
PTKc 124..375 CDD:270623 83/273 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.