DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and AT3G32410

DIOPT Version :10

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:NP_683622.2 Gene:AT3G32410 / 823028 AraportID:AT3G32410 Length:232 Species:Arabidopsis thaliana


Alignment Length:285 Identity:59/285 - (20%)
Similarity:93/285 - (32%) Gaps:100/285 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 LTESEELKVQISAYLDNVF----------DVAALMEDSETKTSALERVQELEDQLEREIDRNSEF 509
            :.|.:.|.::..|.:..:|          |||..:.:..|.|:.|:  :.|:....|..|..|  
plant     1 MEEKDVLPMEAFAKVQEIFSEAEWLDPNSDVAVTVFNQITATNILQ--ESLDSGSPRSPDSRS-- 61

  Fly   510 LYKYAELESESLTLKTEREQLAMIRQKLEEELTVMQRMLQH---NEQELKKRDTLLHTKNM---- 567
                 .|||   ||:..:|         :.:|.:.:.::..   :..|.|::||:...|:.    
plant    62 -----LLES---TLEKVKE---------KTKLMIAENIVSSPDTSSPEWKEKDTMSSHKSYADPN 109

  Fly   568 -------ELQTLSRSLPRSASSGDGSLANGGLMAGSTSGAASLTLPPPPPPMPASPTASSAAPPP 625
                   |.:.|..|:.|:..|...|                       |.|..||..|      
plant   110 SILKKVDESRGLRFSVQRNVHSKIFS-----------------------PRMVQSPVTS------ 145

  Fly   626 PPPPAPPAPPPPPGFSPLGSPSGSLA---------------STAPSPPHAPPMLSSFQPPPPPVA 675
            |.|...|....|...|...|...:|.               ||:.||  |.|.: ||.|...|:.
plant   146 PLPNRSPTQGSPASISRFHSSPSTLGITSILNDHGTCKGEESTSSSP--ASPSI-SFLPTLHPMT 207

  Fly   676 GFMPAPDGAMTIKRKVPTKYKLPTL 700
            ...|        |..:...:.||.|
plant   208 PSQP--------KNLLHNVHSLPHL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:461886
Drf_FH3 374..567 CDD:461885 26/124 (21%)
FH2 687..1063 CDD:396655 4/14 (29%)
AT3G32410NP_683622.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.