DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and AT3G07540

DIOPT Version :9

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:NP_566311.1 Gene:AT3G07540 / 819943 AraportID:AT3G07540 Length:841 Species:Arabidopsis thaliana


Alignment Length:502 Identity:114/502 - (22%)
Similarity:185/502 - (36%) Gaps:134/502 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 SGAASLTLPPPPPPMPASPTASSAAPPPPPPPAPPAPPP--PPGFSPLGSPSGSLASTAPSPPHA 660
            |.||::|||                ||..||||.|.|||  ||..|.:...||...|.:.     
plant   419 SAAAAVTLP----------------PPQRPPPAMPEPPPLVPPSQSFMVQKSGKKLSFSE----- 462

  Fly   661 PPMLSSFQPPPPPVAGFMPAPDGAMTIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFK 725
                             :|...|..|..|..|   ||..|.|..::|:..|...::.|.      
plant   463 -----------------LPQSCGEGTTDRPKP---KLKPLPWDKVRPSSRRTNTWDRLP------ 501

  Fly   726 QIDFNEFEERFKIGIGGALRNGSNGTEVDGSL--------QSSKRFKRPDNVSLLEHTRLRNIAI 782
                               .|.||......||        |.||         :|:..:.:|:|:
plant   502 -------------------YNSSNANSKQRSLSCDLPMLNQESK---------VLDPRKSQNVAV 538

  Fly   783 SRRKLGMPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQQL--LTEEDK 845
            ....|.:..:||..|:.......|.:|.:|.|.::.|::.|.|.    :|...|..:  |...::
plant   539 LLTTLKLTTNDVCQALRDGHYDALGVELLESLARVAPSEEEEKK----LISYSDDSVIKLAPSER 599

  Fly   846 FMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYL 910
            |:.:|..|..:..::..:..:.:|...|..:......|..|..:|:.||....::...|..|   
plant   600 FLKELLNVPFVFKRVDALLSVASFDSKVKHLKRSFSVIQAACEALRNSRMLLRLVGATLEAG--- 661

  Fly   911 NSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAK-----FPELLNFESELYGTDKAA 970
              .|.|.|:.|||::|..|:|.||:|.|:|:|..:|..|...     ...:.|..|.|....|:|
plant   662 --MKSGNAHDFKLEALLGLVDIKSSDGRTSILDSVVQKITESEGIKGLQVVRNLSSVLNDAKKSA 724

  Fly   971 ----SVALENVVADVQELEKGMDLVR----------------KEAELRVKGAQTHILRDFLNNSE 1015
                .|...||....:|::|..:::|                :|:..|           ||..:.
plant   725 ELDYGVVRMNVSKLYEEVQKISEVLRLCEETGHSEEHQWWKFRESVTR-----------FLETAA 778

  Fly  1016 DKLKKIKSDLRHAQEAFKECVEYF--GDSSRNADAAAFFALIVRFTR 1060
            :::|||:.:......|.|:..|||  ..:...|.....|.::..|.:
plant   779 EEIKKIEREEGSTLFAVKKITEYFHVDPAKEEAQLLKVFVIVRDFLK 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:283920
Drf_FH3 374..567 CDD:283917
FH2 687..1063 CDD:280362 89/411 (22%)
AT3G07540NP_566311.1 FH2 470..835 CDD:214697 90/413 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2015
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.