DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and inf2

DIOPT Version :9

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:XP_021322927.1 Gene:inf2 / 792715 ZFINID:ZDB-GENE-140711-5 Length:238 Species:Danio rerio


Alignment Length:135 Identity:34/135 - (25%)
Similarity:72/135 - (53%) Gaps:3/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 IMCLRAIMNNKYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKG-GHEIILGSFD 384
            :.|:||:||:..|.:.::.:...:..::.:|...:...|..|.|||||:.:... ||.:.|.:.:
Zfish   106 VSCVRAVMNSSAGIHFIVDNEGYVRKLSQALDTSNTMVKKQVFELLAAL
SMFSSEGHRLALDALE 170

  Fly   385 NFKDVCQEKRRFQTLMEYFMNFEAFNIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKY 449
            ::|.|..::.||..:|....:.:  |:.:||..:..:|.::.|.:.:..|..::.||..|.|.:.
Zfish   171 HYKCVKTQQYRFSVIMNELRSTD--NVPYMVTLLSVINALIFSADGLQQRDKMRKEFIGLQLLQL 233

  Fly   450 LERIR 454
            |.::|
Zfish   234 LPKLR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:283920 14/49 (29%)
Drf_FH3 374..567 CDD:283917 20/82 (24%)
FH2 687..1063 CDD:280362
inf2XP_021322927.1 Drf_GBD <98..154 CDD:310750 13/47 (28%)
Drf_FH3 160..>226 CDD:310747 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.