DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and SHTN1

DIOPT Version :9

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:NP_001120683.1 Gene:SHTN1 / 57698 HGNCID:29319 Length:631 Species:Homo sapiens


Alignment Length:598 Identity:122/598 - (20%)
Similarity:213/598 - (35%) Gaps:231/598 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 ADAL------DSPSLKRRSR-HIAKLNMGAATDDIH-----------------VSIMCLRAIMNN 330
            |:||      ::.:|||.|. ::|||.....|::|:                 ||:.|.:.|...
Human    83 AEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQCQKQIKEL 147

  Fly   331 KYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKGGHEIILGSFDNFKDVCQEKRR 395
            :   :.::..:|....:|:.|  ::|::|  ::|::..:..|| ..:.:|.|     :|.:::: 
Human   148 R---DQIVSVQEEKKILAIEL--ENLKSK--LVEVIEEVNKVK-QEKTVLNS-----EVLEQRK- 198

  Fly   396 FQTLMEYFMNFEAFNIDFMVACMQFMNIVVHSVEDMNYRVHLQYEF----TALGLDKYLERIRLT 456
                             .:..|.:...:.|...|:|...:.|:.:.    .:...:.::|:.:|.
Human   199 -----------------VLEKCNRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLK 246

  Fly   457 ESEELKVQIS----AYLDNVFDVAALMED-SETKTSALERVQELEDQLEREIDRNSEFLYK-YAE 515
            ....|.:|.|    ..|..:.:.|.|.:. .|.:....::|:|||:|||      :|.|:| ...
Human   247 RQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQKVKELEEQLE------NETLHKEIHN 305

  Fly   516 LESESLTLKTEREQLAMIRQKLEEELTVMQRMLQHNEQELKKRDTLLHTKNMELQTLSRSLPRSA 580
            |:.:...|:.::::|.:..|..||:    .|.|:|:..||:||                     .
Human   306 LKQQLELLEEDKKELELKYQNSEEK----ARNLKHSVDELQKR---------------------V 345

  Fly   581 SSGDGSLANGGLMAGSTSGAASLTLPPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGS 645
            :..:.|:                                    ||||||.||.|||||      :
Human   346 NQSENSV------------------------------------PPPPPPPPPLPPPPP------N 368

  Fly   646 PSGSLASTAPSPPHAPPMLSSFQPPPPPVAGFMPAPDGAMTIKRKVPTKYKLPTLNWIALKPNQV 710
            |..||.|......|                     |.|:...|.|             |.:|...
Human   369 PIRSLMSMIRKRSH---------------------PSGSGAKKEK-------------ATQPETT 399

  Fly   711 RGTIFNELDDEKIFKQIDFNEFEERFKIGIGGALR------------NGSNGTE--VD------G 755
                 .|:.|   .|:....|..:|.|.|:  .||            ..|.|.|  ||      |
Human   400 -----EEVTD---LKRQAVEEMMDRIKKGV--HLRPVNQTARPKTKPESSKGCESAVDELKGILG 454

  Fly   756 SLQ---SSKRFKR--PDNVSLLEHTRLRNIAISRRKL-------------------GMPIDDVIA 796
            :|.   ||:..|.  |:|    ..|.|..| :.|||:                   .||:...::
Human   455 TLNKSTSSRSLKSLDPEN----SETELERI-LRRRKVTAEADSSSPTGILATSESKSMPVLGSVS 514

  Fly   797 AIHSLDLKKLSLE 809
            ::....|.|.:||
Human   515 SVTKTALNKKTLE 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:283920 22/104 (21%)
Drf_FH3 374..567 CDD:283917 40/202 (20%)
FH2 687..1063 CDD:280362 37/167 (22%)
SHTN1NP_001120683.1 DUF972 141..>189 CDD:283750 9/55 (16%)
Tmemb_cc2 <268..350 CDD:287269 26/112 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..511 56/279 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..566 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.