DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and Fnbp4

DIOPT Version :9

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:NP_001013177.3 Gene:Fnbp4 / 311183 RGDID:1309238 Length:1021 Species:Rattus norvegicus


Alignment Length:567 Identity:103/567 - (18%)
Similarity:159/567 - (28%) Gaps:299/567 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 DVAALMEDSETKTSALERVQELEDQLEREIDRNSEFLYKYAELESESLTLKTEREQLAMIRQK-- 536
            |...:.|:|:.:....|..::::.|:..:::...:..::..||.:   ||.::.|.|.:.||.  
  Rat   497 DSEKINENSDKEAEVEESSEKIKVQIAPKVEEEQDLKFQIGELAN---TLTSKFEFLGINRQSIS 558

  Fly   537 ------LEEELTV------------MQRMLQHNEQELK-------------------KRDTLLHT 564
                  |:.|..:            ::|.||...::||                   :|...::.
  Rat   559 NFHMLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNE 623

  Fly   565 KNMELQ----------------TLSRSLPR------------SASSGDGSLANGGLMAGSTSGAA 601
            ::.|.|                ....|||:            ||.|.:.|  .|.|...|.||..
  Rat   624 QSGESQWEFPDGEEEEESQAQEVRDESLPKLTEKDKTCTDSNSAESSENS--TGSLCKESFSGQV 686

  Fly   602 S-------------------------LTLPPPPPPMPASPTASSAAPPPPPPPAPPAP------- 634
            |                         |.:||||||.|.||      |||||||.||.|       
  Rat   687 SSSLMPLTPFWTLLQSNVPVLQPPLPLEMPPPPPPPPESP------PPPPPPPPPPPPLEDGEIQ 745

  Fly   635 -----------PPPPGFS----------------------------------------------- 641
                       ||.||..                                               
  Rat   746 EVEMEDEGSEEPPAPGTEEDTPLKPSTQTTVVTSQSSVDSTASSPPSTKAVKRKAPEISTAVVQR 810

  Fly   642 ----------------------------------------------------------------- 641
                                                                             
  Rat   811 SATIGSSPVLYSQSAIAAGHQAVGMAHQAVSVSHAAAGMGHPTRGMSLQSNYLGLAAAPAILSYA 875

  Fly   642 ----PLG--SPS-------GSLASTA---PSPPHAPPMLSSFQPPPPPVAGFMPAPDGAMTIKRK 690
                |:|  :||       |::|:.|   |.||..||..|:  |||||.|...|.|:.....||:
  Rat   876 ECSVPIGVTTPSLQPAQARGTVAAPAVVEPPPPPPPPPTST--PPPPPPAPKGPPPEKTRKGKRE 938

  Fly   691 --VPTKYKLPTL--NWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIGIGGALRNGSNGT 751
              ..:|.|:|:|  .|.:::         .|||:|                        :.|:.:
  Rat   939 KAKKSKTKMPSLVKKWQSIQ---------RELDEE------------------------DNSSSS 970

  Fly   752 EVDGSLQSSKRFKRPDNVSLLEHTRLRN-----------IAISRRKL 787
            |.|....:.||.:......|:.....||           ..:.|||:
  Rat   971 EEDRESTAQKRIEEWKQQQLVSGLAERNANFEALPEDWRARLKRRKM 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:283920
Drf_FH3 374..567 CDD:283917 21/131 (16%)
FH2 687..1063 CDD:280362 22/116 (19%)
Fnbp4NP_001013177.3 WW 222..249 CDD:395320
WW 604..635 CDD:238122 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.