DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and Fhdc1

DIOPT Version :10

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:NP_001099907.1 Gene:Fhdc1 / 295161 RGDID:1311955 Length:1148 Species:Rattus norvegicus


Alignment Length:144 Identity:33/144 - (22%)
Similarity:54/144 - (37%) Gaps:51/144 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VKEDPRNAAIIIRLHFHDCFVQGCDGSVLLDETETLQGEKKASPNINSLKGYKI--VDRIKNIIE 116
            ::||.||                  |..|:...|.:.||:...|:...::.:||  |::..:.|.
  Rat    64 IEEDFRN------------------GLKLMLLLEAISGERLPKPDKGKMRFHKIANVNKALDFIS 110

  Fly   117 SECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFY 181
            |:  ||    .|::|||.                         |:...||......:.:||.:|.
  Rat   111 SK--GV----KLVSIGAE-------------------------EIVDGNLKMTLGMIWTIILRFA 144

  Fly   182 SQGLSVEDMVALIG 195
            .|.:|||:..|..|
  Rat   145 IQDISVEETSAKEG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:461886 29/121 (24%)
Drf_FH3 374..567 CDD:461885
FH2 687..1063 CDD:396655
Fhdc1NP_001099907.1 FH2 93..457 CDD:396655 23/97 (24%)
PTZ00449 <559..760 CDD:185628
PHA03307 733..>1128 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.