DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frl and LOC101882228

DIOPT Version :9

Sequence 1:NP_729954.2 Gene:Frl / 39561 FlyBaseID:FBgn0267795 Length:1183 Species:Drosophila melanogaster
Sequence 2:XP_005174151.2 Gene:LOC101882228 / 101882228 -ID:- Length:411 Species:Danio rerio


Alignment Length:405 Identity:101/405 - (24%)
Similarity:188/405 - (46%) Gaps:76/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   806 LSLEN-VELLQKMVPTDAEVKSYKEYIIERKDQ-QLLTEEDKFMLQLSRVERISSKLAIMNYMGN 868
            |..|| |:.|.|::|...::.:    :.|.||: :.|.|.::|.:.:|.|:|:..:|..:.:...
Zfish    12 LLTENMVQSLLKLLPEQEQLNT----LSEMKDEYEELAESEQFGVVISSVKRLKPRLTAILFKLQ 72

  Fly   869 FVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKR-GPAYGFKLQSLDTLIDT 932
            |.:.|:.:.|.|.::..|...|::|..|..:|||.|..||:||:..| ..|:||.:..|..|.||
Zfish    73 FEEQVNNVKPDVVAVTAACEELRKSESFAKLLEITLLLGNFLNAGSRNAKAFGFSVSYLCKLRDT 137

  Fly   933 KSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAEL 997
            ||.|::.:|||::..|.:.::||::.|..||...:||:.|:.|.       |:|.:|.:.|:.:.
Zfish   138 KSADQKQTLLHFLAETCQEQYPEVMTFPEELIHVEKASKVSAET-------LQKSLDQMGKQIKS 195

  Fly   998 RVKGAQT------------HILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAA 1050
            ..|..:|            ..:..|::.:.:..:|::....:.::.:::..:||....:......
Zfish   196 LEKDIETFPPPQSDKDKFVEKMTSFVSTARENFEKLQLLHENMEKQYEDLGKYFVFDPKKMTPEE 260

  Fly  1051 FFALIVRFTRAFKQHDQENEQRLRLE---KAAALAASKKENDQVLMRNKVNQKKQQLPS------ 1106
            ||..:..|...|:|..:||::|...|   :.|.||..|.|.::...:.::|  ..|:|:      
Zfish   261 FFGDLNNFRTMFQQAVKENQKRKEAEEKLRRAKLAREKAEKEKEEKQKRIN--SGQIPNINDDGD 323

  Fly  1107 -----NGAL-SLQEA-----------VINELKSKAHSVRE---KKLLQQDEVYN----------- 1140
                 :|.| :||..           ..|..:...|:|..   |:|||:|...:           
Zfish   324 ETGIMDGLLEALQSGAAFRRKRGPRPAANNRRGAGHAVTNLLAKELLQEDAPPSATKKSRQDATD 388

  Fly  1141 --------GALEDIL 1147
                    |:|||:|
Zfish   389 GKESTEDTGSLEDLL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FrlNP_729954.2 Drf_GBD 77..371 CDD:283920
Drf_FH3 374..567 CDD:283917
FH2 687..1063 CDD:280362 70/271 (26%)
LOC101882228XP_005174151.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000085
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.