DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and RNH70

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_011792.1 Gene:RNH70 / 853193 SGDID:S000003508 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:83/322 - (25%)
Similarity:134/322 - (41%) Gaps:105/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KNTTDSTKNVVSPQHNQRKL-----QASMERLQVQQV------------NTSRRAAGSNWMAAAG 78
            |:..|.|:.::..::|..|.     ::|::::.|..:            ||....:..|:....|
Yeast    68 KDVRDMTQYLLQAENNSPKWIDICNRSSLQKMIVLFIPGLQPDDFENGKNTFNEISDDNFKYIPG 132

  Fly    79 GGAAA-------AAGSENQDAKATESAP--------------LSKSARMRMKKKAHRN------- 115
            ..|:.       |.||     |.|..:|              ::|...::.|||...|       
Yeast   133 EIASTFHTFPVMAPGS-----KMTLFSPYNSFINVGLSKMEKINKLKELQKKKKITINDLVLSEQ 192

  Fly   116 -------------------------------RILAMDCEMV----GVGHNTRDDMLARVSIVNRM 145
                                           .|.|:||||.    |:       :|.|:|:||..
Yeast   193 QLVANDYPLDSGDTNFDTDWVQTVDFTHGGSHIFALDCEMCLSEQGL-------VLTRISLVNFD 250

  Fly   146 GHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANG--EDFAAVQNEVMKLI-HGRILVGHGLRNDLA 207
            ..|:.::.|||...:.||.|..|||..:.:..|  :....||.:::|:| ...||:||.|:|||.
Yeast   251 NEVIYEELVKPDVPIVDYLTRYSGITEEKLTVGAKKTLREVQKDLLKIISRSDILIGHSLQNDLK 315

  Fly   208 VLGIRHPFHDIRDTS---HYKPLCKLISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAM 266
            |:.::||.  :.||:   |:|     ..:...||||.|::..|.:.||.|||:|||||||.:
Yeast   316 VMKLKHPL--VVDTAIIYHHK-----AGDPFKPSLKYLSETFLNKSIQNGEHDSVEDARACL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 65/215 (30%)
REX4_like 118..270 CDD:99847 59/159 (37%)
RNH70NP_011792.1 REX1_like 226..374 CDD:99848 59/159 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.