DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and REX3

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_013208.1 Gene:REX3 / 850797 SGDID:S000004097 Length:404 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:56/178 - (31%)
Similarity:87/178 - (48%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEM--VGVGHNTRDDMLARVSIVNRM-GHVLLDKYVKPRKEVTDYRTSVSGIRPQDIAN- 177
            :|::||||  ..:|:.     :.|::||:.. |..|.|..::|..::.|..:..||:...|..| 
Yeast   243 VLSLDCEMAFTSLGYE-----MIRLTIVDFFTGKTLFDHVIQPIGDIVDLNSDFSGVHEIDRTNC 302

  Fly   178 -----GEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLISNT-HT 236
                 ..|....:|.:.|   ..||:||||.|||.|:.:.|  :.:.||:      .|.|.| ..
Yeast   303 PTYKEALDVFLSENLINK---NSILIGHGLENDLNVMRLFH--NKVIDTA------ILYSRTKFK 356

  Fly   237 PSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYN-RVAVD-----WEK 278
            .|||.|...||.::||.|||:|.:||.|.|.:.. ::.:.     |||
Yeast   357 VSLKNLAFEVLSRKIQNGEHDSSQDAIATMDVVKVKIGISPSQNKWEK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 56/178 (31%)
REX4_like 118..270 CDD:99847 53/161 (33%)
REX3NP_013208.1 REX1_like 244..390 CDD:99848 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.