DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and AT3G27970

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_189436.2 Gene:AT3G27970 / 822421 AraportID:AT3G27970 Length:357 Species:Arabidopsis thaliana


Alignment Length:268 Identity:87/268 - (32%)
Similarity:126/268 - (47%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SPQHNQRKLQASMERLQVQQVN---TSRRAAGSNWMAAAGGGAAAAAGSENQDAKATESAPLSKS 103
            ||  |.|::.  .||.|...||   |:|       |||.|          .:| ||......|:|
plant    90 SP--NSRRIH--QERCQFSSVNSGLTTR-------MAALG----------LRD-KAMIDYTSSRS 132

  Fly   104 ARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVS 168
            .           |::|:.|:|||.|.:...|:.|||.|.:...:|:...||||...||.||...:
plant   133 P-----------RVVALSCKMVGGGSDGSLDLCARVCITDESDNVIFHTYVKPSMAVTSYRYETT 186

  Fly   169 GIRPQDIANGEDFAAVQNEVMKLI--------------HGRILVGHGLRNDLAVLGIRHPFHDIR 219
            ||||:::.:......||.::.:.:              ..||||||||.:||..|.:.:|...||
plant   187 GIRPENLRDAMPLKQVQRKIQEFLCNGEPMWKIRPRGGKARILVGHGLDHDLDRLQLEYPSSMIR 251

  Fly   220 DTSHYKPLCKL--ISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEK 282
            ||:.|.||.|.  :||    |||.||:|.||.::..|..:..||..|.|.:|.|:     :|   
plant   252 DTAKYPPLMKTSKLSN----SLKYLTQAYLGYDVHFGIQDPYEDCVATMRLYTRM-----RY--- 304

  Fly   283 KRHQQQHY 290
            ::|:.:.|
plant   305 QKHKIEAY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 67/198 (34%)
REX4_like 118..270 CDD:99847 61/167 (37%)
AT3G27970NP_189436.2 C2H2 Zn finger 17..39 CDD:275371
C2H2 Zn finger 46..63 CDD:275371
REX4_like 136..300 CDD:99847 61/167 (37%)
DnaQ 159..328 CDD:223916 56/166 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.