DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and AT2G48100

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001031560.1 Gene:AT2G48100 / 819422 AraportID:AT2G48100 Length:344 Species:Arabidopsis thaliana


Alignment Length:187 Identity:68/187 - (36%)
Similarity:104/187 - (55%) Gaps:17/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRK 158
            :|:..|.|..|..|:|       .:|:||||||.|.:...|..|.|.:|:...:|:...:|:|..
plant   116 STQRNPSSSLAGSRLK-------AMALDCEMVGGGADGTIDQCASVCLVDDDENVIFSTHVQPLL 173

  Fly   159 EVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHG--------RILVGHGLRNDLAVLGIRHPF 215
            .|||||..::|:..:|:.:|.....|:..|...:.|        .:||||.||:|::.|.:.:|.
plant   174 PVTDYRHEITGLTKEDLKDGMPLEHVRERVFSFLCGGQNDGAGRLLLVGHDLRHDMSCLKLEYPS 238

  Fly   216 HDIRDTSHYKPLCKLISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRV 272
            |.:|||:.|.||.|  :|..:.|||.|||:.||.:||.|:|...||..:||.:|.|:
plant   239 HLLRDTAKYVPLMK--TNLVSQSLKYLTKSYLGYKIQCGKHEVYEDCVSAMRLYKRM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 66/181 (36%)
REX4_like 118..270 CDD:99847 60/159 (38%)
AT2G48100NP_001031560.1 REX4_like 134..291 CDD:99847 60/158 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.