DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and ISG20L2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001290024.1 Gene:ISG20L2 / 81875 HGNCID:25745 Length:353 Species:Homo sapiens


Alignment Length:287 Identity:90/287 - (31%)
Similarity:145/287 - (50%) Gaps:24/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PRQKQFDMNRSRANNLDSSRSGSANNKNTTDSTKNVVSPQHNQRKLQASMERL-----QVQQVNT 64
            |::|....:......||...:.|......:....:|.:......:.|:::.::     :.|:.::
Human    77 PKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSS 141

  Fly    65 SRRAAGSNWMAAAGGGAAAAAGSENQDAKATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGH 129
            .::::..|.........:..|.|||:.:.|::..|               .:::|:||||||.|.
Human   142 QKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLP---------------RKMVAIDCEMVGTGP 191

  Fly   130 NTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHG 194
            ......|||.||||..|.||.|:|:.|...:.||||..||||.|.:.|...|...:.:::|::.|
Human   192 KGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTG 256

  Fly   195 RILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLIS--NTHTPSLKRLTKAVLGQEIQTGE-- 255
            :|:|||.:.||...|...||....|||||..||.:...  ...|.|||.|||.:|.::||.|:  
Human   257 KIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSG 321

  Fly   256 HNSVEDARAAMGIYNRVAVDWEKYLEK 282
            |:|||||:|.|.:|..|.|:||::|.:
Human   322 HSSVEDAQATMELYKLVEVEWEEHLAR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 75/187 (40%)
REX4_like 118..270 CDD:99847 69/155 (45%)
ISG20L2NP_001290024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 2/15 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..172 6/46 (13%)
ISG20 180..336 CDD:99852 69/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.