DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and pan2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_005162402.1 Gene:pan2 / 792831 ZFINID:ZDB-GENE-030131-3113 Length:1206 Species:Danio rerio


Alignment Length:228 Identity:62/228 - (27%)
Similarity:98/228 - (42%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SAPLSKSARMRMKKKAHRNRILAMDCEMVGVGH----------------NTRDD----------- 134
            |..|::::..|.::|:|...|..|..||..||.                ..|.|           
Zfish   943 SVLLTEASLARKQRKSHATFIPLMVSEMPQVGDLVGLDAEFVTLNQEEAELRSDGTKSTIKPSQM 1007

  Fly   135 MLARVSIVNRMGH----VLLDKYVKPRKEVTDYRTSVSGIRPQDI---ANGEDFAAVQNEVMKLI 192
            .:||::.|...|.    ..:|.|:..:::|.||.|..|||:|.|:   .:.:....:::..:|| 
Zfish  1008 SVARITCVRGQGQNEGVPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKL- 1071

  Fly   193 HGRIL-------VGHGLRNDLAVLGIRHPFHDIRDTSH--YKPLCKLISNTHTPSLKRLTKAVLG 248
              |.|       |||||:.|..|:.:..|...:.||.:  :.|..::|      ||:.|....|.
Zfish  1072 --RFLIDTGVRFVGHGLQKDFRVINLMVPKDQVIDTVYLFHMPRKRMI------SLRFLAWYFLD 1128

  Fly   249 QEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLE 281
            ..||...|:|:||||.|:.:|       .||||
Zfish  1129 LNIQGETHDSIEDARTALQLY-------RKYLE 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 61/225 (27%)
REX4_like 118..270 CDD:99847 51/194 (26%)
pan2XP_005162402.1 WD40 <204..>295 CDD:295369
Peptidase_C19P 504..923 CDD:239137
UCH_1 519..900 CDD:290159
PAN2_exo 977..1150 CDD:99846 47/188 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.