DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and aen

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001072399.2 Gene:aen / 779853 XenbaseID:XB-GENE-949418 Length:360 Species:Xenopus tropicalis


Alignment Length:321 Identity:102/321 - (31%)
Similarity:136/321 - (42%) Gaps:64/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ANNLDSSRSGSA---NNKNTTDSTK--NVVSPQHNQRKLQASMER---------LQVQQVNTSRR 67
            |:||..|.|||:   |:.|....||  ..|..:...|:.|..::|         |.:.:..|...
 Frog     9 ASNLSCSSSGSSEFLNSSNAEIYTKCQRRVQNRRKTRRHQRFLKRKAFLQQRRLLNIPETGTQEV 73

  Fly    68 AAGSNWMAAAG----------------------GGAAAAAGSE---------NQDAKATESAPLS 101
            ..|....:..|                      |....|.||.         :.|......|..|
 Frog    74 LKGKTKCSVNGNDQCFCEQIADMEMGSQIKTLLGTLPVAPGSSITGNKPSTFDYDDSGLSVAGSS 138

  Fly   102 KSARMR-----MKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVT 161
            .|:|..     :|.    .:.:|:||||||.|...:...|||.||||..|.|:.|||:||...:.
 Frog   139 SSSRASSPLSWLKP----GKCVAIDCEMVGTGPGGKISELARCSIVNYRGDVVYDKYIKPELPIA 199

  Fly   162 DYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKP 226
            ||||..|||....:.|...|...|.|::|::..:.:|||.|.||...|...||...|||||....
 Frog   200 DYRTRWSGITKHSLKNAISFKTAQKEILKILKDKRVVGHALHNDFRALKYFHPHSQIRDTSKISL 264

  Fly   227 LCKLISNTHTP-----SLKRLTKAVLGQEIQTGE--HNSVEDARAAMGIYNRVAVDWEKYL 280
            |.|   |...|     |||.|...:||:.||.|.  |:|||||.|::.:|..|...||:.|
 Frog   265 LKK---NAGLPEKAGVSLKTLALNLLGKRIQVGRNGHSSVEDALASLELYKLVEDQWEEEL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 77/193 (40%)
REX4_like 118..270 CDD:99847 68/158 (43%)
aenNP_001072399.2 DnaQ 150..>323 CDD:223916 74/180 (41%)
DnaQ_like_exo 156..312 CDD:299142 68/158 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.