DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Eqtn

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_081365.2 Gene:Eqtn / 67753 MGIID:1915003 Length:337 Species:Mus musculus


Alignment Length:248 Identity:42/248 - (16%)
Similarity:79/248 - (31%) Gaps:80/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DMNRSRANNLDSSRSGSANNKNTTDSTKNVVSPQHNQRKLQASMERLQVQQVNTSRRAAGSNWMA 75
            |.|....:.|:.:...:..|:.|.:..|::.........::.|  .:.|........|...|:.|
Mouse    47 DGNSVALHKLEENEMDTPANEKTGNYYKDIKQYVFTTPNIKGS--EVSVTATTNLEFAVKKNYKA 109

  Fly    76 AAGGGAAAAAGSENQDAKATE--SAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLAR 138
            :    ...|:|.|.:.::::.  |.| :..|...:..||.....::||.:               
Mouse   110 S----KPTASGEEEKPSESSRKTSTP-NIPAFWTILSKAVNETAVSMDDK--------------- 154

  Fly   139 VSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDI-ANGEDFAAVQNEV-MKLIHGRILV--- 198
                        |::.:|             |...|: |..||..:...|: :||:.|..|:   
Mouse   155 ------------DQFFQP-------------IPASDLNATNEDKLSELEEIKLKLMLGISLMTLV 194

  Fly   199 --------------------------GHGLRNDLAVLGIRHPFHDIRDTSHYK 225
                                      .:.:..:||.|...||...:.|||..|
Mouse   195 LLIPLLIFCFATLYKLRHLRDKSYESQYSINPELATLSYFHPTEGVSDTSFSK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 26/157 (17%)
REX4_like 118..270 CDD:99847 23/139 (17%)
EqtnNP_081365.2 Afaf 64..245 CDD:291984 37/227 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..130 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..283
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.