Sequence 1: | NP_001189105.1 | Gene: | CG6833 / 39559 | FlyBaseID: | FBgn0036405 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081365.2 | Gene: | Eqtn / 67753 | MGIID: | 1915003 | Length: | 337 | Species: | Mus musculus |
Alignment Length: | 248 | Identity: | 42/248 - (16%) |
---|---|---|---|
Similarity: | 79/248 - (31%) | Gaps: | 80/248 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 DMNRSRANNLDSSRSGSANNKNTTDSTKNVVSPQHNQRKLQASMERLQVQQVNTSRRAAGSNWMA 75
Fly 76 AAGGGAAAAAGSENQDAKATE--SAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLAR 138
Fly 139 VSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDI-ANGEDFAAVQNEV-MKLIHGRILV--- 198
Fly 199 --------------------------GHGLRNDLAVLGIRHPFHDIRDTSHYK 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6833 | NP_001189105.1 | DnaQ | 100..>283 | CDD:223916 | 26/157 (17%) |
REX4_like | 118..270 | CDD:99847 | 23/139 (17%) | ||
Eqtn | NP_081365.2 | Afaf | 64..245 | CDD:291984 | 37/227 (16%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 110..130 | 3/23 (13%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..283 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0847 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |