DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo1

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_011241832.1 Gene:Rexo1 / 66932 MGIID:1914182 Length:1228 Species:Mus musculus


Alignment Length:225 Identity:66/225 - (29%)
Similarity:96/225 - (42%) Gaps:31/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RAAGSNW-------MAAAGGGAAAAAGSENQDAKATESAPLSKSARMRMKKKAHRNRILAMDCEM 124
            |.|| .|       .||.|......|....||.:........::.:..:.:.||.. :.|:||||
Mouse  1012 RVAG-GWETQYMCCSAAVGSVGCQVAKQHVQDGRKENLEGFVRTFQKELPEDAHAG-VFALDCEM 1074

  Fly   125 VGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGEDFAAVQNEVM 189
               .:.|....|.||::|:....|:.|.:|||..||.||.|..||:...|:.   |.:....:|.
Mouse  1075 ---SYTTYGLELTRVTVVDTDMQVVYDTFVKPDNEVVDYNTRFSGVTEADLV---DTSITLRDVQ 1133

  Fly   190 KLI-----HGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLISNTHTPSLKRLTKAVLGQ 249
            .::     ...||:||.|.:||..|.:.|  ..:.|||...|  ..:...:..||:.|....|.|
Mouse  1134 AVLLSMFSADTILIGHSLESDLLALKVIH--GTVVDTSVLFP--HRLGLPYKRSLRNLMADYLRQ 1194

  Fly   250 EIQ--TGEHNSVEDARAAMGIYNRVAVDWE 277
            .||  ...|:|.|||.|.|.:     |.|:
Mouse  1195 IIQDNVDGHSSSEDASACMHL-----VIWK 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 56/185 (30%)
REX4_like 118..270 CDD:99847 52/158 (33%)
Rexo1XP_011241832.1 PHA03307 150..>461 CDD:223039
EloA-BP1 794..969 CDD:374185
REX1_like 1068..1216 CDD:99848 52/162 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.