DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and rexo1

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001119888.1 Gene:rexo1 / 564551 ZFINID:ZDB-GENE-030131-1650 Length:1207 Species:Danio rerio


Alignment Length:162 Identity:52/162 - (32%)
Similarity:76/162 - (46%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDM-LARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGE- 179
            :.|:||||.    .|:..: |.||:::|....|:.|.:|||...|.||.|..||:...|:.|.. 
Zfish  1046 VYALDCEMC----YTKQGLELTRVTVINSELKVVYDTFVKPGSRVVDYNTRFSGVTADDLENTTI 1106

  Fly   180 DFAAVQNEVMKLIHG-RILVGHGLRNDLAVLGIRHPFHDIRDTS----H-----YKPLCKLISNT 234
            ....||..::.:... .||:||.|.:||..|.:.|..  :.||:    |     ||   :.:.|.
Zfish  1107 SLRDVQAVLLSMFSADSILIGHSLESDLFALKLIHSM--VVDTAIVFPHRLGLPYK---RALRNL 1166

  Fly   235 HTPSLKRLTKAVLGQEIQTGEHNSVEDARAAM 266
            ....|||:.      :...|.|:|.|||||.|
Zfish  1167 MADYLKRII------QDNVGGHDSSEDARACM 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 52/161 (32%)
rexo1NP_001119888.1 EloA-BP1 785..946 CDD:464914
REX1_like 1047..1195 CDD:99848 52/161 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.