DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and rexo1

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001119888.1 Gene:rexo1 / 564551 ZFINID:ZDB-GENE-030131-1650 Length:1207 Species:Danio rerio


Alignment Length:162 Identity:52/162 - (32%)
Similarity:76/162 - (46%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDM-LARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGE- 179
            :.|:||||.    .|:..: |.||:::|....|:.|.:|||...|.||.|..||:...|:.|.. 
Zfish  1046 VYALDCEMC----YTKQGLELTRVTVINSELKVVYDTFVKPGSRVVDYNTRFSGVTADDLENTTI 1106

  Fly   180 DFAAVQNEVMKLIHG-RILVGHGLRNDLAVLGIRHPFHDIRDTS----H-----YKPLCKLISNT 234
            ....||..::.:... .||:||.|.:||..|.:.|..  :.||:    |     ||   :.:.|.
Zfish  1107 SLRDVQAVLLSMFSADSILIGHSLESDLFALKLIHSM--VVDTAIVFPHRLGLPYK---RALRNL 1166

  Fly   235 HTPSLKRLTKAVLGQEIQTGEHNSVEDARAAM 266
            ....|||:.      :...|.|:|.|||||.|
Zfish  1167 MADYLKRII------QDNVGGHDSSEDARACM 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 52/162 (32%)
REX4_like 118..270 CDD:99847 52/161 (32%)
rexo1NP_001119888.1 EloA-BP1 785..948 CDD:292495
REX1_like 1047..1195 CDD:99848 52/161 (32%)
DnaQ 1060..>1196 CDD:223916 46/144 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.