DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and isg20l2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001096663.1 Gene:isg20l2 / 558447 ZFINID:ZDB-GENE-070928-8 Length:321 Species:Danio rerio


Alignment Length:309 Identity:103/309 - (33%)
Similarity:149/309 - (48%) Gaps:50/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PRQKQFDMNRSRANNLDSSRSGSANNKNTTD---------STKNVVSPQHNQR---KLQASMERL 57
            |||              ..|||.:..|:..|         .::.:::.:.||:   |:|....:.
Zfish    12 PRQ--------------GGRSGKSRGKSKQDRFLSRRRYLESEGLITEKQNQKQPEKIQPKKTKK 62

  Fly    58 QVQQV------NTSRRAAGSNWMAAAGG-----GAAAAAGSENQDAKATESAPLSK---SARMRM 108
            :.:.|      ::..||....:.:....     .::|.|.|..........|.:|:   :.||.:
Zfish    63 KPRNVRFNVGEHSKPRAFFPKFTSYLPNSTYEPSSSAQAYSRTSTYLFPSHANISQRDLTQRMAV 127

  Fly   109 KKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQ 173
            .:.....:.||:||||||.|.......|||.|||:..|.|:.||||||...||||||..||||.|
Zfish   128 PRPPGPIKYLALDCEMVGTGPKGAQSELARCSIVSYDGDVVYDKYVKPINPVTDYRTRWSGIRRQ 192

  Fly   174 DIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLISNTHTP- 237
            |:.:...|...|.|::|:|.|:::|||.:.||...|...||....||||.. ||  |......| 
Zfish   193 DLLHATPFYHAQKEIVKIITGKVVVGHAIHNDFKALKYFHPAFQTRDTSRI-PL--LNEKAGFPE 254

  Fly   238 ----SLKRLTKAVLGQEIQTG--EHNSVEDARAAMGIYNRVAVDWEKYL 280
                |||:||:|:|.::||||  .|:|||||:|.|.:|..|...||:.|
Zfish   255 KQCVSLKKLTQAILKRDIQTGYRGHSSVEDAKATMELYKVVERMWEQKL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 84/191 (44%)
REX4_like 118..270 CDD:99847 76/158 (48%)
isg20l2NP_001096663.1 DnaQ 133..>293 CDD:223916 76/162 (47%)
ISG20 137..293 CDD:99852 76/158 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4544
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.