DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and EQTN

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_065692.2 Gene:EQTN / 54586 HGNCID:1359 Length:294 Species:Homo sapiens


Alignment Length:264 Identity:47/264 - (17%)
Similarity:87/264 - (32%) Gaps:103/264 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DMNRSRANNLDSSRS-GSANNKN------------TT---DSTKNVVSPQ---------HNQRKL 50
            |:|:....|.|.:.: ..||.||            ||   :.|::.:|.:         .|.:.:
Human    36 DVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYVFTTQNPNGTESEISVRATTDLNFALKNDKTV 100

  Fly    51 QA-SMERLQVQQVNTSRRAAGSN-----------W--MAAAGGGAAAAAGSENQ--------DAK 93
            .| :.|:..:::..|:...:..|           |  :|.|..|.|.....::|        |..
Human   101 NATTYEKSTIEEETTTSEPSHKNIQRSTPNVPAFWTMLAKAINGTAVVMDDKDQLFHPIPESDVN 165

  Fly    94 AT--ESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKP 156
            ||  |:.|..:..::::               |:|            :|::..:..|:|..:.  
Human   166 ATQGENQPDLEDLKIKI---------------MLG------------ISLMTLLLFVVLLAFC-- 201

  Fly   157 RKEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDT 221
              ..|.|:     :|.....:.|...:|..|                  ||.:...||...:.||
Human   202 --SATLYK-----LRHLSYKSCESQYSVNPE------------------LATMSYFHPSEGVSDT 241

  Fly   222 SHYK 225
            |..|
Human   242 SFSK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 19/126 (15%)
REX4_like 118..270 CDD:99847 19/108 (18%)
EQTNNP_065692.2 Afaf 53..243 CDD:291984 41/243 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..126 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.