DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Eqtn

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038966505.1 Gene:Eqtn / 500502 RGDID:1563332 Length:308 Species:Rattus norvegicus


Alignment Length:127 Identity:24/127 - (18%)
Similarity:45/127 - (35%) Gaps:36/127 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DMNRSRANNLDSSRSGSANNKNTTDSTKNV-----VSPQHNQRKLQASME-----RLQVQQVNTS 65
            |.|.:....|:.:...:..|:.|.:..|::     .:|.....|.:.|:.     :..::...:|
  Rat    46 DENSAIFQKLEDNGGDTPANEKTGNYYKDIKQYVFTTPDSKGTKTEVSVTATTDLKFTMKDYKSS 110

  Fly    66 RRAAGSNWMAAAGGGAAAAAGSENQDAKATESAPLSKS------ARMRMKKKAHRNRILAMD 121
            :               |.|:|.|::     .|.|..||      |...|..||.....::||
  Rat   111 K---------------ATASGEEDK-----RSEPSRKSSTPNVPAFWTMLAKAINETAVSMD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 8/28 (29%)
REX4_like 118..270 CDD:99847 2/4 (50%)
EqtnXP_038966505.1 Afaf 63..250 CDD:405924 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.