DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and rexo4

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001006868.1 Gene:rexo4 / 448635 XenbaseID:XB-GENE-6258946 Length:414 Species:Xenopus tropicalis


Alignment Length:317 Identity:121/317 - (38%)
Similarity:165/317 - (52%) Gaps:44/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATPRQK--QFDMNRSRANNLD---------------SSRSGSANNKNTTDSTKNVVSPQHNQRKL 50
            |||.:|  :.|...|...|.|               |.....|...:....||.|...:..:||:
 Frog    85 ATPSEKFPKKDQKVSEKKNGDPEPPKSTPKINGGITSVTPKEAKAPSQAPPTKAVEVKKEKKRKI 149

  Fly    51 QASMERLQVQQVNTSRRAAGSN---------W--------MAAAGGGAAAAAGSENQDAKATESA 98
            :|.    ..:|::..::..|..         |        :.||.|..|.....|.|.  .||:|
 Frog   150 KAE----GTEQLDPPKKPQGGTQPEPPKVDIWFDDVDPDDIEAALGPEAGRIAREMQG--VTETA 208

  Fly    99 PLSKSARMRMKKKAHR--NRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVT 161
            | ..:.::.:|:||..  .|.:||||||||||.:..:.|||||||||..|..:.||||:|.:.||
 Frog   209 P-PTAEKVLVKEKAFEGLTRTVAMDCEMVGVGLDGEESMLARVSIVNLFGKCVYDKYVRPTERVT 272

  Fly   162 DYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKP 226
            ||||:||||||.||.|||.|..||.||.:::.||.||||.:.|||.:|.:.||...||||..|||
 Frog   273 DYRTAVSGIRPDDIKNGEAFKDVQAEVAEILRGRTLVGHAVHNDLKILFLDHPKKAIRDTQKYKP 337

  Fly   227 LCKLISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKK 283
            ..:.:.:.. ||||.|.:.:|..::|||||.||:||:|||.:|......||..::.|
 Frog   338 FKEKVKSGR-PSLKLLCEKILNVKVQTGEHCSVQDAQAAMRLYTMEKKCWEAAIKAK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 91/184 (49%)
REX4_like 118..270 CDD:99847 84/151 (56%)
rexo4NP_001006868.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..174 18/92 (20%)
REX4_like 229..380 CDD:99847 84/151 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3871
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 1 1.000 - - FOG0004095
OrthoInspector 1 1.000 - - oto104439
Panther 1 1.100 - - LDO PTHR12801
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1084
SonicParanoid 1 1.000 - - X2840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.