DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo5

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_011240147.1 Gene:Rexo5 / 434234 MGIID:1919402 Length:858 Species:Mus musculus


Alignment Length:208 Identity:60/208 - (28%)
Similarity:91/208 - (43%) Gaps:63/208 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TESAPLSKSARMRMKKKAHRNRILAMDCE--MVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPR 157
            |:|:||                 ..:|||  :..:|..     |.|:|:|...|:.|:|:.|||.
Mouse   219 TDSSPL-----------------FGLDCEVCLTSMGKE-----LTRISLVTEGGYCLIDELVKPD 261

  Fly   158 KEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIH-----GRILVGHGLRNDLAVLGIRHPFHD 217
            .::.||.||.:|| .::|.|  .......:|.||:.     ..:||||.|..||.||.:.||:  
Mouse   262 LKILDYLTSFTGI-TKEILN--PVTTKLKDVQKLLRELLPPDAVLVGHCLDLDLRVLKMIHPY-- 321

  Fly   218 IRDTS---------HYKPLCKLISNTHTPSLKRLTKAVLGQEIQTGE---HNSVEDARAAMGIYN 270
            :.|||         .:|             |..|.:.:||::||...   .:.:||||||:.:..
Mouse   322 VIDTSLLYAGKQGRRFK-------------LTFLARVILGKDIQCPNKLGRDGIEDARAALELLQ 373

  Fly   271 RVAVDWEKYLEKK 283
            .    :.||..||
Mouse   374 Y----FLKYGPKK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 55/201 (27%)
REX4_like 118..270 CDD:99847 52/170 (31%)
Rexo5XP_011240147.1 REX1_like 225..373 CDD:99848 52/170 (31%)
RRM_SF 490..560 CDD:388407
RRM_SF 586..656 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.