DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo5

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_011240147.1 Gene:Rexo5 / 434234 MGIID:1919402 Length:858 Species:Mus musculus


Alignment Length:43 Identity:11/43 - (25%)
Similarity:21/43 - (48%) Gaps:8/43 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GVNPVVVEIGEEDNNNYDN-------IVSDKEKLPMMYIGGKL 122
            |:| |.|.:||.:..:.|.       ::..|.:..::|:..||
Mouse   296 GIN-VAVVLGEVNERSVDQADYCGVMVIQVKSRKEIVYLSDKL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 2/5 (40%)
Rexo5XP_011240147.1 REX1_like 225..373 CDD:99848 11/43 (26%)
RRM_SF 490..560 CDD:473069
RRM_SF 586..656 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.