DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and CG12877

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001034073.1 Gene:CG12877 / 43333 FlyBaseID:FBgn0039544 Length:991 Species:Drosophila melanogaster


Alignment Length:183 Identity:60/183 - (32%)
Similarity:83/183 - (45%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIAN-GED 180
            |.|:||||....|...   |.||::|:..|..:.|..|||..::.||.|:.|||....::| ...
  Fly   833 IYALDCEMCYTTHGIE---LTRVTVVDINGRSVYDALVKPDNQIVDYNTTYSGITEAMLSNETRT 894

  Fly   181 FAAVQNEVMKLIHGR-ILVGHGLRNDLAVLGIRHPFHD-IRDTS----H---------YKPLCKL 230
            ...||..:|.:.|.: :||||.|.:||..|.:   .|| :.|||    |         .|.||  
  Fly   895 IRDVQAVLMSMFHAKTVLVGHSLESDLKALKL---IHDVVVDTSVLFPHKMGPPKKRALKTLC-- 954

  Fly   231 ISNTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKK 283
            |.|     |||:.     ||.:.| |:|.|||...:.:.       :.||..|
  Fly   955 IEN-----LKRII-----QESEAG-HDSAEDAEVCIQLI-------KYYLRNK 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 59/181 (33%)
REX4_like 118..270 CDD:99847 56/167 (34%)
CG12877NP_001034073.1 CDC45 129..>199 CDD:280821
EloA-BP1 572..736 CDD:292495
REX1_like 834..983 CDD:99848 56/174 (32%)
DnaQ 847..>991 CDD:223916 53/169 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.