DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo5

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster


Alignment Length:194 Identity:60/194 - (30%)
Similarity:89/194 - (45%) Gaps:35/194 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QDAKATES--APLSKSARMRMKKKAHRNRILAMDCEM--VGVGHNTRDDMLARVSIVNRMGHVLL 150
            |:.|.|:.  ||::           :|:.:..:||||  ...|.|.    |.|:||||.....:.
  Fly   338 QNFKFTKDLYAPVT-----------NRSPMFGVDCEMCHTEAGCNE----LTRISIVNENYETVY 387

  Fly   151 DKYVKPRKEVTDYRTSVSGIRP---QDIANGEDFAAVQNEVMKLI-HGRILVGHGLRNDLAVLGI 211
            :..|.|...:|||.|..|||..   :.:....|  .||.||.:|: ...||||..|.:||..:.:
  Fly   388 ETLVLPNNRITDYLTQYSGITAEIMEQVTKRLD--VVQKEVSELLPPDAILVGQSLNSDLNAMKM 450

  Fly   212 RHPFHDIRDTSHYKPLCKLISNT--HTPSLKRLTKAVLGQEIQTG--EHNSVEDARAAMGIYNR 271
            .||:  :.|||    :|...|..  ....||.|.|..|.:.||..  .|:|:||:||.:.:..:
  Fly   451 MHPY--VIDTS----VCFNTSGVRRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRATLKLVKK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 55/182 (30%)
REX4_like 118..270 CDD:99847 54/161 (34%)
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 54/161 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.