DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and ISG20

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001290162.1 Gene:ISG20 / 3669 HGNCID:6130 Length:181 Species:Homo sapiens


Alignment Length:162 Identity:66/162 - (40%)
Similarity:100/162 - (61%) Gaps:5/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIA 176
            |....::||||||||:|.: |:..|||.|:||..|.||.||:::|..|:|||||.|||:.||.:.
Human     2 AGSREVVAMDCEMVGLGPH-RESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMV 65

  Fly   177 NGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCK--LISNTHTPSL 239
            ....||..:.|:::|:.|:::|||.|::|...|......:.|.|||..:.|.:  .:.:....||
Human    66 GATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSL 130

  Fly   240 KRLTKAVLGQEIQTG--EHNSVEDARAAMGIY 269
            :.|::.:|.:.||..  .|:|||||||.|.:|
Human   131 RVLSERLLHKSIQNSLLGHSSVEDARATMELY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 66/162 (41%)
REX4_like 118..270 CDD:99847 65/156 (42%)
ISG20NP_001290162.1 DnaQ_like_exo 8..163 CDD:415823 65/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.