DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and PAN2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster


Alignment Length:297 Identity:77/297 - (25%)
Similarity:121/297 - (40%) Gaps:78/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSSRSGSANNKNTTDS--------------------TKNVVSPQHNQRKLQASMERLQVQQVNTS 65
            |.|.|.|..:...|:|                    .:.:|||........|:::.||       
  Fly   968 DDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQ------- 1025

  Fly    66 RRAAGSNWMAAAGGGAAAAAGSENQDAKATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHN 130
                 |:.|..:|...|..|.....:.:..|..|..|:|.::             .|.|      
  Fly  1026 -----SDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIK-------------PCHM------ 1066

  Fly   131 TRDDMLARVSIVNRMGHV----LLDKYVKPRKEVTDYRTSVSGIRPQDI-AN--GEDFAAVQNEV 188
                .:||:|.:...|..    .:|.|:..:::|.||.|..|||:|.|: ||  .:...|::...
  Fly  1067 ----SVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSY 1127

  Fly   189 MKLIH----GRILVGHGLRNDLAVLGIRHPFHDIRDTSH--YKPLCKLISNTHTPSLKRLTKAVL 247
            .||.:    |.|.|||||:||..|:.|..|...|.||.|  :.|..:::      ||:.|....|
  Fly  1128 QKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV------SLRFLAWHFL 1186

  Fly   248 GQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKKR 284
            |.:||:..|:|:||||..:.:|..    :.|..|:|:
  Fly  1187 GTKIQSETHDSIEDARTTLQLYKH----YLKLQEEKK 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 57/195 (29%)
REX4_like 118..270 CDD:99847 52/164 (32%)
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 58/201 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.