DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and CG3165

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_608732.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster


Alignment Length:163 Identity:25/163 - (15%)
Similarity:54/163 - (33%) Gaps:62/163 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPR 157
            :.|.:.|:.|......|:|..|:              ...||               |::...|:
  Fly   220 ETTPNRPILKPTEAFAKRKLLRD--------------GDEDD---------------LEEQTPPK 255

  Fly   158 KEVTDYRTS---VSGIR--------PQDIANGED----------FAAVQNEVMKLIHGRILVGHG 201
            ::..::|:.   .||.:        |:.:.|.|.          .:|.|.|...::..:::..:|
  Fly   256 RKPDEFRSRRQLFSGCKCAENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYG 320

  Fly   202 L-----RNDLAVLGIRHPFHDIRDTSHYKPLCK 229
            :     ..:.|:     ||..:....  .|:|:
  Fly   321 IDFLAFAEEQAI-----PFQQVVPLG--SPVCR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 19/138 (14%)
CG3165NP_608732.1 TREX1_2 20..173 CDD:99839
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.