DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and prage

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster


Alignment Length:156 Identity:57/156 - (36%)
Similarity:88/156 - (56%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANG-ED 180
            :.|:||||...|   |...:.:||:|...|.::.:.:|:|..::.||.|..|||...|:.:| :.
  Fly   685 VYALDCEMSYTG---RGLDVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKS 746

  Fly   181 FAAVQNEVMKLIHG-RILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLISNTHTPSLKRLTK 244
            .|.||.::::||.. .||:||||.|||..|.:.|  :.:.|||...|.|.  ...:..:|:.|||
  Fly   747 LAEVQRDLLQLITADTILIGHGLENDLRALRLVH--NTLIDTSISFPHCN--GFPYRRALRHLTK 807

  Fly   245 AVLGQEIQTGE----HNSVEDARAAM 266
            ..|.::||.|:    |:|.||:||.|
  Fly   808 VHLKRDIQAGDGTTGHSSFEDSRACM 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 57/156 (37%)
REX4_like 118..270 CDD:99847 57/155 (37%)
prageNP_001188528.1 PH-like <614..650 CDD:302622
DnaQ 675..>837 CDD:223916 57/156 (37%)
REX1_like 686..837 CDD:99848 57/155 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12801
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.