DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo5

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038934563.1 Gene:Rexo5 / 309036 RGDID:1305412 Length:846 Species:Rattus norvegicus


Alignment Length:199 Identity:63/199 - (31%)
Similarity:91/199 - (45%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TESAPLSKSARMRMKKKAHRNRILAMDCE--MVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPR 157
            |:|:||                 ..:|||  :..:|..     |.|:|:|...|:.|:|:.|||.
  Rat   217 TDSSPL-----------------FGLDCEVCLTSMGKE-----LTRISLVAEGGYCLMDELVKPD 259

  Fly   158 KEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIH-----GRILVGHGLRNDLAVLGIRHPFHD 217
            .::.||.||.||| .::|.|  .......:|.||:.     ..:||||.|..||.||.|.||:  
  Rat   260 FKILDYLTSFSGI-TKEILN--PVTTKLKDVQKLLRELLPPDAVLVGHCLDLDLRVLKIIHPY-- 319

  Fly   218 IRDTSHYKPLCKLISNTHTPSLKRLTKAVLGQEIQTGE---HNSVEDARAAMGIYNRVAVDWEKY 279
            :.|||    |..:........|..|.|.:||::||...   |:.:||||.|:.:...    :.||
  Rat   320 VIDTS----LLYIGKQGRRFKLTFLAKVILGKDIQCPNKLGHDGIEDARTALELVQY----FLKY 376

  Fly   280 LEKK 283
            ..||
  Rat   377 GPKK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 58/192 (30%)
REX4_like 118..270 CDD:99847 55/161 (34%)
Rexo5XP_038934563.1 REX1_like 223..371 CDD:99848 55/161 (34%)
RRM_SF 508..578 CDD:418427
RRM_SF 604..674 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.