DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Rexo5

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038934563.1 Gene:Rexo5 / 309036 RGDID:1305412 Length:846 Species:Rattus norvegicus


Alignment Length:199 Identity:63/199 - (31%)
Similarity:91/199 - (45%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TESAPLSKSARMRMKKKAHRNRILAMDCE--MVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPR 157
            |:|:||                 ..:|||  :..:|..     |.|:|:|...|:.|:|:.|||.
  Rat   217 TDSSPL-----------------FGLDCEVCLTSMGKE-----LTRISLVAEGGYCLMDELVKPD 259

  Fly   158 KEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIH-----GRILVGHGLRNDLAVLGIRHPFHD 217
            .::.||.||.||| .::|.|  .......:|.||:.     ..:||||.|..||.||.|.||:  
  Rat   260 FKILDYLTSFSGI-TKEILN--PVTTKLKDVQKLLRELLPPDAVLVGHCLDLDLRVLKIIHPY-- 319

  Fly   218 IRDTSHYKPLCKLISNTHTPSLKRLTKAVLGQEIQTGE---HNSVEDARAAMGIYNRVAVDWEKY 279
            :.|||    |..:........|..|.|.:||::||...   |:.:||||.|:.:...    :.||
  Rat   320 VIDTS----LLYIGKQGRRFKLTFLAKVILGKDIQCPNKLGHDGIEDARTALELVQY----FLKY 376

  Fly   280 LEKK 283
            ..||
  Rat   377 GPKK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 55/161 (34%)
Rexo5XP_038934563.1 REX1_like 223..371 CDD:99848 55/161 (34%)
RRM_SF 508..578 CDD:473069
RRM_SF 604..674 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.