DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Isg20

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038961562.1 Gene:Isg20 / 293052 RGDID:1306407 Length:184 Species:Rattus norvegicus


Alignment Length:142 Identity:61/142 - (42%)
Similarity:85/142 - (59%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGEDF 181
            ::||||||||:|.. |...|||.||||....||.|||::|..|:|||||.||||.||.:|....|
  Rat     7 VVAMDCEMVGLGPQ-RVSGLARCSIVNVHSAVLYDKYIQPEGEITDYRTQVSGITPQHMARATPF 70

  Fly   182 AAVQNEVMKLIHGRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPL---CKLISNTHTPSLKRLT 243
            |..:.|:::|:.|:::|||.|::|.:.|......:.|.|||....|   .||...:.. ||:.|.
  Rat    71 AEARLEILQLLKGKLVVGHDLKHDFSALKEDMRKYTIYDTSTDMLLWHEAKLHCYSRV-SLRLLC 134

  Fly   244 KAVLGQEIQTGE 255
            |.:|.:.||..:
  Rat   135 KRLLHKSIQNDQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 61/142 (43%)
REX4_like 118..270 CDD:99847 61/141 (43%)
Isg20XP_038961562.1 DnaQ_like_exo 8..159 CDD:415823 61/141 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562214at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.