DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Trex1

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_035767.4 Gene:Trex1 / 22040 MGIID:1328317 Length:314 Species:Mus musculus


Alignment Length:52 Identity:14/52 - (26%)
Similarity:21/52 - (40%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 HNTRDDMLARVSIVNRMGHVLL---DKYVKPRKEV-----TDYRTSVSGIRP 172
            |....|:|..:||.......||   |::.:|...|     |...|..:.:||
Mouse   195 HTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYGTPATTGTTNLRP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 14/52 (27%)
Trex1NP_035767.4 TREX1_2 14..211 CDD:99839 5/15 (33%)
Necessary for endoplasmic reticulum localization. /evidence=ECO:0000269|PubMed:18724932 236..314 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..284 3/10 (30%)
Interaction with UBQLN1. /evidence=ECO:0000250|UniProtKB:Q9NSU2 244..314 2/3 (67%)
Necessary for cytoplasmic retention. /evidence=ECO:0000269|PubMed:18724932 281..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.