DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and C05C8.5

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_504838.1 Gene:C05C8.5 / 179116 WormBaseID:WBGene00015462 Length:594 Species:Caenorhabditis elegans


Alignment Length:191 Identity:67/191 - (35%)
Similarity:95/191 - (49%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KKKAHRNRILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQ 173
            ||.:..:.:.::||||.......|:  |.|:|||:...:.:||..|||...:|||.|..|||.| 
 Worm   213 KKISASSPMFSVDCEMCETDVANRE--LTRISIVDEFENTILDTLVKPEGRITDYVTRWSGITP- 274

  Fly   174 DIANG--EDFAAVQNEVMKLI-HGRILVGHGLRNDLAVLGIRHPF-HDIRDTSHYKPLCKLISNT 234
            |:..|  .....||..:..|: ...|||||.|.:||..:.:.||| .|:....:|       :|:
 Worm   275 DMMEGVTTTLGDVQKAIQSLLPPDAILVGHSLEHDLQAMKMTHPFCLDVGHVLNY-------TNS 332

  Fly   235 HTP---SLKRLTKAVLGQEIQTG-EHNSVEDARAAMGI----------YNRVAVDWEKYLE 281
            :|.   |||.||:..||.:||:. .|.|.|||.|||.:          :..|:..| ||.|
 Worm   333 NTEFRNSLKNLTELFLGAQIQSEFGHCSYEDAWAAMRLAQLKLEKGLMFGNVSFGW-KYSE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 67/191 (35%)
REX4_like 118..270 CDD:99847 60/169 (36%)
C05C8.5NP_504838.1 REX1_like 222..372 CDD:99848 60/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.