DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and panl-2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_498519.1 Gene:panl-2 / 175974 WormBaseID:WBGene00017951 Length:1131 Species:Caenorhabditis elegans


Alignment Length:305 Identity:77/305 - (25%)
Similarity:115/305 - (37%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDSSRSGSANNKNTTDSTKNVV----SPQHNQRKLQASMERLQVQQVNT----SRRAAGSNWMAA 76
            ||:......|.:|..:.|..|.    ||     .:.:|...:..|.|:.    ..|.....|...
 Worm   797 LDAMIHAVGNGENDVNWTHPVTLLRESP-----VISSSWTLINEQLVSRLHDHEARHIDGRWKLP 856

  Fly    77 AGGGAAAAAGSENQDAKATE---------------SAPLSKSARMRMKKKAHRNRILAMDCEMVG 126
                |..|...:|.|.|.:|               |..::..|...:::......::.:|.|.:.
 Worm   857 ----ALLAYKKKNFDVKTSEDIISNDLFLAEENLASNGMTSLAVQSLEELPKEKELVGLDAEFIK 917

  Fly   127 V--------GHNTRDDMLARVSIVNRMG-HVLLDKYVK--PRKEVTDYRTSVSGIRPQDI--ANG 178
            :        |...:...:.|.|.|:..| .::.|.:||  ...||.||.|..|||...|:  ...
 Worm   918 IKTDLLEFDGKTVQMRAVGRASCVDSTGERIIFDDHVKLTDDVEVVDYLTKFSGIVKADLCPTTS 982

  Fly   179 EDFAAVQNEVMKLIH-----GRILVGHGLRNDLAVLGIRHPFHDIRDTSHYKPLCKLISNTHTPS 238
            |.:......::..:|     |...|||.|.||..||.:......|.||   ..|.:| ......|
 Worm   983 EKYLTTHKRLLLRMHVLIQRGVTFVGHALHNDFTVLNVHVAESQIIDT---VTLMRL-GTQRMLS 1043

  Fly   239 LKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKK 283
            |:.|.|.:||:.||...|:||.|||.|:.:|       .||||.|
 Worm  1044 LQFLVKEILGETIQMEAHDSVVDARYALKLY-------RKYLEIK 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 56/200 (28%)
REX4_like 118..270 CDD:99847 50/169 (30%)
panl-2NP_498519.1 WD40 <17..322 CDD:225201
WD40 28..324 CDD:295369
Peptidase_C19 493..>613 CDD:271592
PAN2_exo 909..1075 CDD:99846 51/176 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.