DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and pqe-1

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_498135.2 Gene:pqe-1 / 175731 WormBaseID:WBGene00004095 Length:1647 Species:Caenorhabditis elegans


Alignment Length:157 Identity:48/157 - (30%)
Similarity:75/157 - (47%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGED 180
            |:.|:|||||   :......|||:::|:...:.:||.:|||..:|.|..|..||:..:.|.:..|
 Worm  1477 RVYALDCEMV---YTIAGPALARLTMVDMQRNRVLDVFVKPPTDVLDPNTEFSGLTMEQINSAPD 1538

  Fly   181 -FAAVQNEVMKLIHG-RILVGHGLRNDLAVLGIRHP--------FHDIRDTSHYKPLCKLISNTH 235
             ......::.|.::. .||:||.|.:||..:.:.|.        |...|||   |...|::    
 Worm  1539 TLKTCHQKLFKYVNADTILIGHSLESDLKAMRVVHKNVIDTAILFRSTRDT---KVALKVL---- 1596

  Fly   236 TPSLKRLTKAVLGQEIQTGEHNSVEDA 262
              |.|.|.|.:.|.......|:|:|||
 Worm  1597 --SAKLLHKNIQGDNEDAIGHDSMEDA 1621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 48/157 (31%)
REX4_like 118..270 CDD:99847 47/155 (30%)
pqe-1NP_498135.2 PHA03160 <285..405 CDD:165431
Amelogenin <377..502 CDD:197891
EloA-BP1 1230..1364 CDD:292495
REX1_like 1479..1629 CDD:99848 47/155 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.