DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and Pan2

DIOPT Version :9

Sequence 1:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_006513048.1 Gene:Pan2 / 103135 MGIID:1918984 Length:1205 Species:Mus musculus


Alignment Length:232 Identity:62/232 - (26%)
Similarity:100/232 - (43%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SAPLSKSARMRMKKKAHRNRILAMDCEMVGVGH----------------NTRDD----------- 134
            |..|::::..|.::|.|...|..|..||..||.                ..|.|           
Mouse   945 SVLLAEASLARKQRKTHTTFIPLMLNEMPQVGDLVGLDAEFVTLNEEEAELRSDGTKSTIKPSQM 1009

  Fly   135 MLARVSIVNRMGH----VLLDKYVKPRKEVTDYRTSVSGIRPQDI---ANGEDFAAVQNEVMKLI 192
            .:||::.|...|.    ..:|.|:..:::|.||.|..|||:|.|:   .:.:....:::..:|| 
Mouse  1010 SVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKL- 1073

  Fly   193 HGRIL-------VGHGLRNDLAVLGIRHPFHDIRDTSH--YKPLCKLISNTHTPSLKRLTKAVLG 248
              |.|       |||||:.|..|:.:..|...:.||.:  :.|..::|      ||:.|....|.
Mouse  1074 --RFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMI------SLRFLAWYFLD 1130

  Fly   249 QEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKKRH 285
            .:||...|:|:||||.|:.:|       .||||..::
Mouse  1131 LKIQGETHDSIEDARTALQLY-------RKYLELSKN 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 61/225 (27%)
REX4_like 118..270 CDD:99847 51/194 (26%)
Pan2XP_006513048.1 WD40 75..357 CDD:421866
UCH_1 516..902 CDD:404327
PAN2_exo 979..1152 CDD:99846 47/188 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.