DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6833 and rexo1

DIOPT Version :10

Sequence 1:NP_648689.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002938865.3 Gene:rexo1 / 100145565 XenbaseID:XB-GENE-961786 Length:1135 Species:Xenopus tropicalis


Alignment Length:161 Identity:51/161 - (31%)
Similarity:79/161 - (49%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ILAMDCEMVGVGHNTRDDMLARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGE-D 180
            |.|:||||.   :.|:...|.||:::|....|:.|.:|||..::.||.|..||:..:|:.|.. .
 Frog   974 IFALDCEMC---YTTQGLELTRVTVINSELKVVYDTFVKPDNKIVDYNTRFSGVTEEDLQNTTMT 1035

  Fly   181 FAAVQNEVMKLIHGR-ILVGHGLRNDLAVLGIRHPFHDIRDTS----H-----YKPLCKLISNTH 235
            ...||..::.:...: ||:||.|.:||..|.:.||  .:.||:    |     ||...:.:...|
 Frog  1036 LRDVQAVLLCMFSSKTILIGHSLESDLFALKMIHP--TVVDTAIVFPHRLGLPYKRALRSLMADH 1098

  Fly   236 TPSLKRLTKAVLGQEIQTGEHNSVEDARAAM 266
               |||:.      :...|.|:|.|||.:.|
 Frog  1099 ---LKRII------QDSVGGHDSSEDACSCM 1120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6833NP_648689.1 REX4_like 118..270 CDD:99847 50/160 (31%)
rexo1XP_002938865.3 PTZ00108 <248..532 CDD:240271
EloA-BP1 716..874 CDD:464914
REX1_like 975..1123 CDD:99848 50/160 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.